DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and dbx1b

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_571253.1 Gene:dbx1b / 30416 ZFINID:ZDB-GENE-000128-11 Length:322 Species:Danio rerio


Alignment Length:278 Identity:70/278 - (25%)
Similarity:102/278 - (36%) Gaps:62/278 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 LQIPLVPNCPPPAALHTFLSPALLHSYEQRLAWDYQRQLQEHFQAQAQLLRQMTLNPAIIASEDG 161
            :.:|.|  ..|||...:||.|:        .|......||..|...:..|.:..|.   |:....
Zfish     1 MMLPSV--IAPPAMYPSFLRPS--------SALSLPPALQSAFTTHSSFLVEDLLR---ISRPAA 52

  Fly   162 SSERSQRSSSS----------NGSTECCSPTQAEKVEKRSQEDRMEVPKKSPEEQPKG------- 209
            ...||..|.|:          |.::.......:..:.|||..     |:.|....|..       
Zfish    53 FMHRSIPSPSASPPATGVTTLNTTSSAVHVAMSTALAKRSSS-----PQTSISSDPNYLKFGVNA 112

  Fly   210 --ASKSSGDTPLDALFQLSTKNFD-------------EEQDPATLN------IFA----TRSNPK 249
              ||.:...:|...:..::.|.|.             ....||:.:      .||    .|..|:
Zfish   113 ILASTTRNASPPPPVQGMNAKTFPFPCFDGSFHPFIRASYFPASSSAVPIPGTFAWPLTARGKPR 177

  Fly   250 KKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRDME-EL 313
            :....|..|::.|...|||.|..|||:|..||.::|..|||.::||..||||||.|.:...| ||
Zfish   178 RGMLRRAVFSDVQRKALEKMFQKQKYISKPDRKKLATKLGLKDSQVKIWFQNRRMKWRNSKEREL 242

  Fly   314 KKDVQC-EKIPDQSADPN 330
            .....| |:......:||
Zfish   243 LSSGGCREQTLPTKMNPN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 45/159 (28%)
Homeobox 254..307 CDD:278475 26/52 (50%)
dbx1bNP_571253.1 COG5576 <173..296 CDD:227863 35/88 (40%)
Homeobox 182..235 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..266 7/23 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..322
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.