DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and Nkx1-2

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001163947.1 Gene:Nkx1-2 / 293568 RGDID:1306744 Length:305 Species:Rattus norvegicus


Alignment Length:302 Identity:73/302 - (24%)
Similarity:114/302 - (37%) Gaps:93/302 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KSSPVRVK-SFSIADILGRGHEEDRVEKKPERIAIPNALPGVPAPLALINERLQIPLVPNCPPPA 109
            |::|...| |||:.|||.        .:|..|.|:|      |..||.:                
  Rat    10 KAAPSHHKISFSVLDILD--------PQKFTRAALP------PVRLAAL---------------- 44

  Fly   110 ALHTFLSPALLHSYEQRLAWDYQRQLQEHFQAQAQLLRQMTLNPAIIASED---GSSERSQRSSS 171
                                          :|:..|:.       :.|.||   |:...||.:..
  Rat    45 ------------------------------EAKKSLVE-------VEAGEDACSGNPIGSQETPD 72

  Fly   172 S-NGSTECCSPTQAEKVEKRSQEDRMEVPKKSPEEQPKGASKSSGDTPLDA-LFQLSTKNFDEEQ 234
            : .|.|:..||.:..:.|:  :|:..:..:....|:.:||...|    |:| ...:.|:....:.
  Rat    73 AVGGGTDPASPVEGSEAEE--EEEAEDAGRAQRPERWQGAHAGS----LEAGAVAVGTEESGADG 131

  Fly   235 DPATLNIFATRSNPK-----------KKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGL 288
            .||:.   .:..:|:           |.|::|||||.:|:..||.:|...:|||..:|..:|..|
  Rat   132 LPASP---GSPGSPRPRRRRAESSCAKPRRARTAFTYEQLVALENKFRATRYLSVCERLNLALSL 193

  Fly   289 GLSNAQVITWFQNRRAKLKRDMEELKKDVQCEKIPDQSADPN 330
            .|:..||..||||||.|.|:........||......|...||
  Rat   194 SLTETQVKIWFQNRRTKWKKQNPGADGAVQAGGSAPQPGTPN 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 42/137 (31%)
Homeobox 254..307 CDD:278475 25/52 (48%)
Nkx1-2NP_001163947.1 Homeobox 160..213 CDD:395001 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.