DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and Dbx1

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001009644.1 Gene:Dbx1 / 292934 RGDID:1308896 Length:335 Species:Rattus norvegicus


Alignment Length:358 Identity:80/358 - (22%)
Similarity:109/358 - (30%) Gaps:128/358 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 PPAALHTFLSPALLHSYEQRLAWDYQRQLQEHFQAQAQLL--------RQMTLNPAIIASEDGSS 163
            |||...:.|.|....:..|        .||..|...:..|        |..|..|..|.:...|.
  Rat     9 PPAGYPSLLRPTPTLTLPQ--------SLQSAFSGHSSFLVEDLIRISRPPTYLPRSIPTASLSP 65

  Fly   164 ERSQRSS--SSNGSTECCSPTQAEKVEKRSQEDRMEVPKKSPEEQPKGASKSSGDTPLDALFQLS 226
            .|.:..:  :.:|:::..||                           |:....|.:|..||...|
  Rat    66 PRQEAPTALADSGTSDLGSP---------------------------GSGSRRGSSPQTALSPAS 103

  Fly   227 TKNF-------------DEEQDPATLNI------------------------------------- 241
            ...|             ..|..||.|..                                     
  Rat   104 EPTFLKFGVNAILSSAPRRETSPALLQSPPPKTFAFPYFEGSFQPFIRSSYFPASSSVVPIPGTF 168

  Fly   242 ---FATRSNPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRR 303
               .|.|..|::....|..|::.|...|||.|..|||:|..||.::|..|||.::||..||||||
  Rat   169 SWPLAARGKPRRGMLRRAVFSDVQRKALEKTFQKQKYISKPDRKKLASKLGLKDSQVKIWFQNRR 233

  Fly   304 AKLKRDME-ELKKDVQCEK---------IPDQS----ADPNRSHHNHP------HYHQQHQHY-- 346
            .|.:...| ||.....|.:         .||.|    ..|.....:.|      |.....:|.  
  Rat   234 MKWRNSKERELLSSGGCREQTLPTKLNPHPDLSDVGQKGPGDEEEDSPGASLAYHAPPDPRHLLE 298

  Fly   347 -------AHMQSIGSDRDM-DKDRCREKEKDKD 371
                   ||..|.|...|. |.|...|.|:|::
  Rat   299 GPLPASPAHSSSPGKPSDFSDSDEDEEGEEDEE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 48/192 (25%)
Homeobox 254..307 CDD:278475 26/52 (50%)
Dbx1NP_001009644.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..102 11/72 (15%)
Homeobox 184..237 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..335 21/92 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.