DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and VENTX

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_055283.1 Gene:VENTX / 27287 HGNCID:13639 Length:258 Species:Homo sapiens


Alignment Length:160 Identity:49/160 - (30%)
Similarity:72/160 - (45%) Gaps:22/160 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 SSERSQRSSSSNGSTE------CCSPTQAEKVEKRSQEDRMEVPKKSPEEQPKGA---SKSSGDT 217
            |..|..:..||.||.:      |..||...:....|........:.|...:|..|   .:::|.:
Human     6 SPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQAVSIKEAAGSS 70

  Fly   218 PLDALFQLSTKNFDEEQDPATLNIFATRSNPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRD 282
            .|.|          .|:..|.|   :...|..:..:.|||||.:|:..||..|.:.:||||.:|.
Human    71 NLPA----------PERTMAGL---SKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERK 122

  Fly   283 EIAGGLGLSNAQVITWFQNRRAKLKRDMEE 312
            .:|..:.||..|:.|||||||.|.||.|::
Human   123 RLAREMQLSEVQIKTWFQNRRMKHKRQMQD 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 38/110 (35%)
Homeobox 254..307 CDD:278475 26/52 (50%)
VENTXNP_055283.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..93 20/99 (20%)
Homeobox 95..147 CDD:306543 26/51 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..248
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.