DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and Tlx3

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_036012630.1 Gene:Tlx3 / 27140 MGIID:1351209 Length:338 Species:Mus musculus


Alignment Length:357 Identity:81/357 - (22%)
Similarity:118/357 - (33%) Gaps:154/357 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PQRTPSPANSDVSVGSPSPPPLRSLNMKRLRLLRSPISLEHDRQKSSPVRVKSFSIADILGRGHE 66
            |:|...||.|..|...|..||          .:.:|.|    .|...|....||.|         
Mouse    26 PRRNGDPAASPPSPAQPFRPP----------RMEAPAS----AQTPHPHEPISFGI--------- 67

  Fly    67 EDRVEKKPERIAIP--------------------NALPGVP----------------------AP 89
             |::...|::.:.|                    .|.|.:|                      ||
Mouse    68 -DQILNSPDQDSAPAPRGPDGASYLGGPPGGRPGAAYPSLPASFAGLGAPFEDAGSYSVNLSLAP 131

  Fly    90 LALINERLQIPLVPNCPP--PAALHTFLSPALLHSYEQRLAWDYQRQLQEHFQAQAQLLRQMTLN 152
            ..:|......||....||  |:||     ||:                                 
Mouse   132 AGVIRVPAHRPLPGAVPPPLPSAL-----PAM--------------------------------- 158

  Fly   153 PAI--IASEDGSSERSQRSSSSNGSTECCSPTQAEKVEKRSQEDRMEVPKKSPEEQPKGASKSSG 215
            |::  ::|..|.:.....||                  :|..:||.              :.::.
Mouse   159 PSVPTVSSLGGLNFPWMESS------------------RRFVKDRF--------------TAAAA 191

  Fly   216 DTPLDALFQLSTKNFDEEQDPATLNIFATRSNPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPAD 280
            .||.....::.             :.:..|:.||:| |.||:|:..||.||||||..||||:.|:
Mouse   192 LTPFTVTRRIG-------------HPYQNRTPPKRK-KPRTSFSRVQICELEKRFHRQKYLASAE 242

  Fly   281 RDEIAGGLGLSNAQVITWFQNRRAKLKRDMEE 312
            |..:|..|.:::|||.|||||||.|.:|...|
Mouse   243 RAALAKSLKMTDAQVKTWFQNRRTKWRRQTAE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 39/107 (36%)
Homeobox 254..307 CDD:278475 30/52 (58%)
Tlx3XP_036012630.1 PRK07764 <20..>109 CDD:236090 22/106 (21%)
Homeobox 216..270 CDD:395001 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.