DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and tlx3b

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_739572.1 Gene:tlx3b / 266965 ZFINID:ZDB-GENE-021021-1 Length:300 Species:Danio rerio


Alignment Length:251 Identity:73/251 - (29%)
Similarity:103/251 - (41%) Gaps:60/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 SEDGSSERSQRSSSSNGSTECC----SPTQAEK------------VEKRSQEDR----------- 195
            |...|||.|..|||::|.   |    |||.|..            :....:|..           
Zfish    43 STRNSSESSSGSSSASGG---CYHLGSPTGASATPYTTLTGTFHGIAAPYEESSPYGVNLTLAPG 104

  Fly   196 --MEVPKKSP---EEQPKGASKSSGDTPLDALFQLSTKNFDEEQDPATLNIFAT---------RS 246
              :.||...|   ...|..||...|...|...:..|::.|.:::..|.|..|..         ..
Zfish   105 GVIRVPAHRPLAAAVPPPMASAVPGLGSLSFPWMESSQRFAKDRFAAALTPFTVARRIGHPYQNR 169

  Fly   247 NPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRD-- 309
            .|.|::|.||:|:..||.||||||..||||:.|:|..:|..|.:::|||.|||||||.|.:|.  
Zfish   170 TPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKTLKMTDAQVKTWFQNRRTKWRRQTA 234

  Fly   310 -------------MEELKKDVQCEKIPDQ-SADPNRSHHNHPHYHQQHQHYAHMQS 351
                         |.:|:.|...:.:.|. ..||...|::.....|..|.:|..:|
Zfish   235 EEREAERQQANRLMIQLQHDAFQKSLTDSVPTDPLCIHNSSLFALQNLQPWASEES 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 50/150 (33%)
Homeobox 254..307 CDD:278475 30/52 (58%)
tlx3bNP_739572.1 Homeobox 177..230 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.