DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and Obox6

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_663756.2 Gene:Obox6 / 252830 MGIID:2149036 Length:347 Species:Mus musculus


Alignment Length:249 Identity:55/249 - (22%)
Similarity:96/249 - (38%) Gaps:45/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 LQIPLVPNCPPPAALHTFLSPALLHSYEQRLAWDYQRQLQEHFQAQAQLLRQMTLNPAIIASEDG 161
            ||....|:.|...:||:        .::...:...:...|.|.:....|..||..:|.:|     
Mouse     2 LQYNQSPHMPQDPSLHS--------KFQMSSSAPIEISFQMHQEPARNLPFQMCQSPLVI----- 53

  Fly   162 SSERSQRSSSSNGSTECCSPTQAEKVEKRS---------QEDRMEVPKK----SPEEQPKGASKS 213
              .||...||.:.......|.:::....:|         .:..:.:.:.    ||.:.|..:|..
Mouse    54 --PRSPMQSSHSVPERDLCPQESQGPSGKSSIQMQPGLVMDPALPILRSLLMHSPHQIPSRSSVR 116

  Fly   214 SGDTPLDALFQLSTKNFDEEQDPATLNIFATRSNPKKKRKSRTAFTNQQIFELEKRFLYQKYLSP 278
            :|       ||.|....  .:.|:..:...:...|:|.||.||.:|.:|...|:|.|....|.|.
Mouse   117 AG-------FQGSLGPM--VRSPSYGDRRVSLVTPRKHRKIRTVYTEEQKCVLKKHFHKCTYPSR 172

  Fly   279 ADRDEIAGGLGLSNAQVITWFQNRRAKLKRDMEELKKDVQCEKIPDQSADPNRS 332
            ..|..:|..:|::..::..||:|.|||.||:        ..:.:|....:.|.|
Mouse   173 EQRMALAVLVGVTANEIQIWFKNHRAKSKRE--------SLQNVPAALPETNGS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 33/125 (26%)
Homeobox 254..307 CDD:278475 18/52 (35%)
Obox6NP_663756.2 COG5576 86..>204 CDD:227863 33/134 (25%)
homeodomain 146..204 CDD:238039 22/65 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.