DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and Tlx1

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_006526978.1 Gene:Tlx1 / 21908 MGIID:98769 Length:345 Species:Mus musculus


Alignment Length:96 Identity:42/96 - (43%)
Similarity:57/96 - (59%) Gaps:9/96 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 STKNFDEEQDPATLNIF-ATR--------SNPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPADR 281
            |.:.:.:::....|:.| .||        ..|.||:|.||:||..||.||||||..||||:.|:|
Mouse   182 SNRRYTKDRFTVALSPFTVTRRIGHPYQNRTPPKKKKPRTSFTRLQICELEKRFHRQKYLASAER 246

  Fly   282 DEIAGGLGLSNAQVITWFQNRRAKLKRDMEE 312
            ..:|..|.:::|||.|||||||.|.:|...|
Mouse   247 AALAKALKMTDAQVKTWFQNRRTKWRRQTAE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 42/96 (44%)
Homeobox 254..307 CDD:278475 31/52 (60%)
Tlx1XP_006526978.1 Homeobox 219..273 CDD:365835 31/53 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.