DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and Nkx1-2

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_033149.1 Gene:Nkx1-2 / 20231 MGIID:104806 Length:305 Species:Mus musculus


Alignment Length:279 Identity:66/279 - (23%)
Similarity:107/279 - (38%) Gaps:91/279 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KSSPVRVK-SFSIADILGRGHEEDRVEKKPERIAIPNALPGVPAPLALINERLQIPLVPNCPPPA 109
            |::|...| |||:.|||.        .:|..|.|:|      |..||                  
Mouse    10 KAAPSHHKISFSVLDILD--------PQKFTRAALP------PVRLA------------------ 42

  Fly   110 ALHTFLSPALLHSYEQRLAWDYQRQLQEHFQAQAQLLRQMTLNPAIIASED---GSSERSQRSSS 171
                              |.:.::.|:|                 :.|.:|   |:...||.:..
Mouse    43 ------------------ALEAKKSLEE-----------------VEAGQDACSGNPIGSQETPD 72

  Fly   172 SNG-STECCSPTQAEKVEKRSQEDRMEVPKKSPEEQPKGASKSSGDTPLDALFQLSTKNFDEEQD 235
            :.| ..:..||.:..:.|:  :|:..:..:....|:.:|..:.|   |......:.|:....|..
Mouse    73 AVGRGIDPGSPVEGSEAEE--EEEAEDAGRAHQPERWQGVHEGS---PEARAVAVGTEESGAEGL 132

  Fly   236 PATLNIFATRSNPK-----------KKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLG 289
            ||:.   .:..:|:           |.|::|||||.:|:..||.:|...:|||..:|..:|..|.
Mouse   133 PASP---GSPGSPRPRRRRAESSCAKPRRARTAFTYEQLVALENKFRATRYLSVCERLNLALSLS 194

  Fly   290 LSNAQVITWFQNRRAKLKR 308
            |:..||..||||||.|.|:
Mouse   195 LTETQVKIWFQNRRTKWKK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 36/114 (32%)
Homeobox 254..307 CDD:278475 25/52 (48%)
Nkx1-2NP_033149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..158 21/131 (16%)
Homeobox 160..212 CDD:278475 25/51 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..257 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.