DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and Lbx1

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_034821.2 Gene:Lbx1 / 16814 MGIID:104867 Length:282 Species:Mus musculus


Alignment Length:251 Identity:100/251 - (39%)
Similarity:123/251 - (49%) Gaps:75/251 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 ALPGVPAPLALINERLQIPLVPNCPPPAALHTFLSPALLHSYEQRLAWDYQRQLQEHFQAQAQLL 146
            |.||        .||.:.|| .:.||||..:..|:|   .|.|..|.                  
Mouse     9 AAPG--------EERRRSPL-DHLPPPANSNKPLTP---FSIEDILN------------------ 43

  Fly   147 RQMTLNPAIIASEDGSSERSQRSSSSNGSTECCSPTQAEKVEKRSQEDRMEVPKKSPEEQP-KGA 210
                 .|::           :||.|..|:....:...                |.:|...| .|.
Mouse    44 -----KPSV-----------RRSYSLCGAAHLLAAAD----------------KHAPGGLPLAGR 76

  Fly   211 SKSSGDTPLDALFQLSTKNFD----------EEQDPATLNIFATRSNPKKKRKSRTAFTNQQIFE 265
            :..|..:||.||.:|::|.|.          |.:|..|  ||..|..|||:|||||||||.||:|
Mouse    77 ALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMT--IFGQRQTPKKRRKSRTAFTNHQIYE 139

  Fly   266 LEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRDMEELKKDVQCEK 321
            |||||||||||||||||:||..|||:||||||||||||||||||:||:|.||:..|
Mouse   140 LEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 77/127 (61%)
Homeobox 254..307 CDD:278475 46/52 (88%)
Lbx1NP_034821.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 13/38 (34%)
Homeobox 128..182 CDD:395001 47/53 (89%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..282
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831667
Domainoid 1 1.000 107 1.000 Domainoid score I6523
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1472248at2759
OrthoFinder 1 1.000 - - FOG0002643
OrthoInspector 1 1.000 - - mtm8764
orthoMCL 1 0.900 - - OOG6_107037
Panther 1 1.100 - - O PTHR24336
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5376
SonicParanoid 1 1.000 - - X3367
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.740

Return to query results.
Submit another query.