DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and Hoxd3

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_034598.2 Gene:Hoxd3 / 15434 MGIID:96207 Length:433 Species:Mus musculus


Alignment Length:312 Identity:71/312 - (22%)
Similarity:110/312 - (35%) Gaps:123/312 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PSPPPLRSLNMKRLRLLRSPISLEHDR-------QKSSPVRVKSFSIADI------LGRGHEEDR 69
            |.|||            .:..||:.|.       |.|:|:|..:...|::      .|.|:.:..
Mouse    49 PYPPP------------AAANSLDSDYPSSACSIQSSAPLRAPAHKGAELNGSCMRPGTGNSQGG 101

  Fly    70 VEKKPERIAIPNALPGVPAPLALINERLQIPLVPNCPPPAALHTFLSPALLHSYEQRLAWDYQRQ 134
                    ...|..||       :|...|.|..|..|||                          
Mouse   102 --------GGGNQPPG-------LNSEQQPPQPPPPPPP-------------------------- 125

  Fly   135 LQEHFQAQAQLLRQMTLNPAIIASEDGSSERSQR-----SSSSNGSTECCSPTQAEKVEKRSQED 194
                           ||.|: ..:..||...:::     |:||:.|      |.::::....:|.
Mouse   126 ---------------TLPPS-SPTNPGSGVPAKKTKGGLSASSSSS------TISKQIFPWMKES 168

  Fly   195 RMEVPKKSPEEQPKGASKSSGDTPLDALFQLSTKNFDEEQDPATLNIFATRSNPKKKRKSRTAFT 259
            |.       ..:.|.:..:||:            |.:::..|          .|..|| .|||:|
Mouse   169 RQ-------NSKQKNSCATSGE------------NCEDKSPP----------GPASKR-VRTAYT 203

  Fly   260 NQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRDME 311
            :.|:.||||.|.:.:||....|.|:|..|.|:..|:..||||||.|.|:|.:
Mouse   204 SAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 35/106 (33%)
Homeobox 254..307 CDD:278475 25/52 (48%)
Hoxd3NP_034598.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..198 44/253 (17%)
Antp-type hexapeptide 161..166 0/4 (0%)
Homeobox 199..251 CDD:278475 25/51 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..280
DUF4074 370..431 CDD:290032
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.