DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and Hoxb13

DIOPT Version :10

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_032293.1 Gene:Hoxb13 / 15408 MGIID:107730 Length:286 Species:Mus musculus


Alignment Length:66 Identity:22/66 - (33%)
Similarity:39/66 - (59%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 KKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRDMEEL 313
            ::.||.|..::..|:.|||:.:...|:::...|.:|:....||..|:..||||||.|.|:.:.::
Mouse   216 RRGRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKV 280

  Fly   314 K 314
            |
Mouse   281 K 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 22/66 (33%)
Homeodomain 252..308 CDD:459649 20/55 (36%)
Hoxb13NP_032293.1 HoxA13_N 12..124 CDD:463521
Homeodomain 219..275 CDD:459649 20/55 (36%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:Q92826 219..248 8/28 (29%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000250|UniProtKB:Q92826 260..275 8/14 (57%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:Q92826 272..275 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.