DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and Barhl1

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_476450.1 Gene:Barhl1 / 117232 RGDID:620648 Length:327 Species:Rattus norvegicus


Alignment Length:202 Identity:60/202 - (29%)
Similarity:88/202 - (43%) Gaps:44/202 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 MTLNPAIIASEDGSSERSQRSSSSNGSTECCSPTQAEKVEKRSQEDRMEVPKKS----------- 202
            :.|:|...:|.|.||..|........||..........::...|..::..|.:|           
  Rat    36 LELSPRSESSSDCSSPASPGRDCLETSTSRPGAASGPGLDSHLQPGQLSAPAQSRTVTSSFLIRD 100

  Fly   203 ----------------------PEEQPKGASKSSGD--TPLDALFQLSTKNFDEE---QDPATLN 240
                                  ||...:.|:|:..|  ..||.  .:|:.:.|.|   ::.....
  Rat   101 ILADCKPLAACAPYSSSGQPAAPEPGGRLAAKAGEDFRDKLDK--SVSSASSDSEYKVKEEGDRE 163

  Fly   241 IFATRSNP----KKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQN 301
            |.::|.:|    ||.||:|||||:.|:.:||:.|..|||||..||.|:|..|.|::.||.||:||
  Rat   164 ISSSRDSPPVRLKKPRKARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQN 228

  Fly   302 RRAKLKR 308
            ||.|.||
  Rat   229 RRTKWKR 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 46/112 (41%)
Homeobox 254..307 CDD:278475 29/52 (56%)
Barhl1NP_476450.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90 11/53 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..181 16/69 (23%)
Homeobox 182..235 CDD:395001 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.