DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and hoxa3

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001120901.1 Gene:hoxa3 / 100151729 XenbaseID:XB-GENE-482267 Length:406 Species:Xenopus tropicalis


Alignment Length:262 Identity:64/262 - (24%)
Similarity:97/262 - (37%) Gaps:97/262 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 VEKKPERIAIPNALPGVPAP-----------LALINERL-QIPLV------PNCPPPAALHTFLS 116
            :|.:..|.|.....||...|           :..||.:. |.|::      |..|||:     :|
 Frog    40 LETEYHRPACSLQSPGSAVPHHKANDINESCMRTINSQSNQAPVIPEQQPTPQGPPPS-----VS 99

  Fly   117 PALLHSYEQRLAWDYQRQLQEHFQAQAQLLRQMTLNPAIIASEDGSSERSQRSSSSNGSTECCSP 181
            |.                             |.|.|.|              ::|||.:|...||
 Frog   100 PP-----------------------------QTTSNAA--------------TASSNKATSITSP 121

  Fly   182 TQAEKVEKRSQEDRMEVPKKSPEEQPKGASKSSGDTPLDALFQLSTKNFDEEQDPATLNIFATRS 246
            |.::::....:|.|...      :|.|..|.|||:                       :....:|
 Frog   122 TMSKQIFPWMKESRQNT------KQQKAGSSSSGE-----------------------SCAGDKS 157

  Fly   247 NP--KKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRD 309
            .|  ...:::|||:|:.|:.||||.|.:.:||....|.|:|..|.|:..|:..||||||.|.|:|
 Frog   158 PPGQSSSKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKD 222

  Fly   310 ME 311
            .:
 Frog   223 QK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 35/108 (32%)
Homeobox 254..307 CDD:278475 25/52 (48%)
hoxa3NP_001120901.1 Homeobox 168..221 CDD:395001 25/52 (48%)
DUF4074 344..404 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.