DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and LOC100008066

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_003199819.1 Gene:LOC100008066 / 100008066 -ID:- Length:251 Species:Danio rerio


Alignment Length:343 Identity:79/343 - (23%)
Similarity:118/343 - (34%) Gaps:137/343 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LEHDRQK------SSPVRVKSFSIADILGRGHEEDRVEKKPERIAIPNALPGVPAPLALINERLQ 98
            :|.:..|      ..|:|   |.|..|||      ..|.:..|:..||..|.||.|...:.|..:
Zfish     1 MEREESKPPSKAHQEPIR---FGIDQILG------SAEPESSRLGSPNIAPHVPLPGVSLEESGR 56

  Fly    99 I-----PLVPNCPPPAALHTFLSPALLHSYEQRLAWDYQRQLQEHFQAQAQLLRQMTLNPAIIAS 158
            :     .|:|........|..|:||:                             |:..||:   
Zfish    57 VFGVSSALLPGGVIRVPAHRPLAPAM-----------------------------MSAAPAL--- 89

  Fly   159 EDGSSERSQRSSSSNGSTECCSPTQAEKVEKRSQEDRMEVPKKSPEEQPKGASKSSGDTPLDALF 223
                                |.|                                         :
Zfish    90 --------------------CFP-----------------------------------------W 93

  Fly   224 QLSTKNFDEEQDPATLNIFATR--------SNPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPAD 280
            ..:.:.|.:::.||.:....||        ..|.|::|.||:|:..||.||||||..||||:.|:
Zfish    94 MDNNRRFPKDRLPALIPFTVTRRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAE 158

  Fly   281 RDEIAGGLGLSNAQVITWFQNRRAKLKRDMEE---------------LKKDVQCEKIPDQ-SADP 329
            |..:|..|.:::|||.|||||||.|.:|...|               |:.|...:.|.:. |:||
Zfish   159 RAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAGRQQANRMLLQLQADALQKSISESVSSDP 223

  Fly   330 NRSHHNHPHYHQQHQHYA 347
            ...|::..:..|..|.:|
Zfish   224 LCLHNSSLYALQNLQPWA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 46/149 (31%)
Homeobox 254..307 CDD:278475 30/52 (58%)
LOC100008066XP_003199819.1 Homeobox 132..185 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.