DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B2 and UGT71C5

DIOPT Version :9

Sequence 1:NP_001097859.4 Gene:Ugt49B2 / 42538 FlyBaseID:FBgn0038886 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_172204.1 Gene:UGT71C5 / 837235 AraportID:AT1G07240 Length:480 Species:Arabidopsis thaliana


Alignment Length:508 Identity:108/508 - (21%)
Similarity:180/508 - (35%) Gaps:142/508 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ILAPFFLPVKSHFMMTDAIIRELVKRGHEVTFITPLSL-------AKENLG------PNYREILL 72
            |..|  ||...|.:.|....:.|:.....::.||.||:       |..:|.      |..|.|.|
plant     7 IFVP--LPETGHLLSTIEFGKRLLNLDRRISMITILSMNLPYAPHADASLASLTASEPGIRIISL 69

  Fly    73 PKYDTWADISAMMKTKSALDMIDMSKLTHMRLAQHIGIKSTDFALAHPEVQELIYAKDKKG---K 134
            |:          :.....:.::|.|..|::....|..|     ......:|:|:.:....|   .
plant    70 PE----------IHDPPPIKLLDTSSETYILDFIHKNI-----PCLRKTIQDLVSSSSSSGGGSS 119

  Fly   135 FDLLLVEQFHNEGALMLGYIYEIPAITIATFAYANYFSQVFGFVNPLSYVPNVFLSCTDRMSLWE 199
            ....|:..|...|.:.:|....:|:....|   :|     |||:..|.|:|       :|..|  
plant   120 HVAGLILDFFCVGLIDIGREVNLPSYIFMT---SN-----FGFLGVLQYLP-------ERQRL-- 167

  Fly   200 RLENVVISTAEDVVREVSYYPQQDAVIRKHFSSLLPRVPT----------------VKQLEQ--N 246
                           ..|.:.:.......|..:.:.|||.                ||..|:  .
plant   168 ---------------TPSEFDESSGEEELHIPAFVNRVPAKVLPPGVFDKLSYGSLVKIGERLHE 217

  Fly   247 ISVILLNSYMPLTSPRPMSQNMISVGG--LHILPPKPL--------P-------EHIKNYLDNAE 294
            ...||:||:   |...|.:....|.|.  .|:.|..|:        |       :.:..:||...
plant   218 AKGILVNSF---TQVEPYAAEHFSQGRDYPHVYPVGPVLNLTGRTNPGLASAQYKEMMKWLDEQP 279

  Fly   295 HGAIYF----SLGSQVRSADMPAEKLQIFLDVFASLKQRVLWKFE-------DDQLPNLPDNVK- 347
            ..::.|    |:|.      .||.::.........:..|.:|...       |.|.| ||:... 
plant   280 DSSVLFLCFGSMGV------FPAPQITEIAHALELIGCRFIWAIRTNMAGDGDPQEP-LPEGFVD 337

  Fly   348 -------VEKWLPQADILAHPNVKVFIAHGGLFGMQEAVYHAVPVLGMPFYFDQDIN-IKAGQAA 404
                   |..|.||.|||||.....|::|.|...:||::::.||:...|.|.:|.:| .:..:..
plant   338 RTMGRGIVCSWAPQVDILAHKATGGFVSHCGWNSVQESLWYGVPIATWPMYAEQQLNAFEMVKEL 402

  Fly   405 GYA--IGLDY---------RTISKDQLKSALHALL-KDPKYQANMMKASRIFR 445
            |.|  |.|||         ..:|.|::.:|:.:|: .|...:..:::.|.:.|
plant   403 GLAVEIRLDYVADGDRVTLEIVSADEIATAVRSLMDSDNPVRKKVIEKSSVAR 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B2NP_001097859.4 egt 1..502 CDD:223071 108/508 (21%)
UDPGT 31..497 CDD:278624 104/498 (21%)
UGT71C5NP_172204.1 PLN02167 1..480 CDD:215112 108/508 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.