DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B2 and UGT78D2

DIOPT Version :9

Sequence 1:NP_001097859.4 Gene:Ugt49B2 / 42538 FlyBaseID:FBgn0038886 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_197207.1 Gene:UGT78D2 / 831568 AraportID:AT5G17050 Length:460 Species:Arabidopsis thaliana


Alignment Length:310 Identity:73/310 - (23%)
Similarity:123/310 - (39%) Gaps:75/310 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 ERLENV--VIS---------TAEDVVREVSYYPQQDAVIRKHFSSL---LPRVPTVKQLEQNISV 249
            ||:|..  |||         |.|.||     :...|:|..|....:   |||.          :.
plant   171 ERMEETIGVISGMEKIRVKDTPEGVV-----FGNLDSVFSKMLHQMGLALPRA----------TA 220

  Fly   250 ILLNSYMPL-----TSPRPMSQNMISVGGLHILPPKPLPEHIKN------YLDNAEHGAI-YFSL 302
            :.:||:..|     .:.|...:..:::|.|.:| ...|.:.:::      :::....|:: |.|.
plant   221 VFINSFEDLDPTLTNNLRSRFKRYLNIGPLGLL-SSTLQQLVQDPHGCLAWMEKRSSGSVAYISF 284

  Fly   303 GSQVRSADMPAEKLQIFLDVFASLKQRVLWKFEDDQLPNLP----DNVK----VEKWLPQADILA 359
            |:.:..   |..:|....:...|.|...:|..::..|..||    |..:    |..|.||.::|.
plant   285 GTVMTP---PPGELAAIAEGLESSKVPFVWSLKEKSLVQLPKGFLDRTREQGIVVPWAPQVELLK 346

  Fly   360 HPNVKVFIAHGGLFGMQEAVYHAVPVLGMPFYFDQDINIKAGQAA---------------GYAIG 409
            |....||:.|.|...:.|:|...||::..||:.||.:|.:|.:..               |:...
plant   347 HEATGVFVTHCGWNSVLESVSGGVPMICRPFFGDQRLNGRAVEVVWEIGMTIINGVFTKDGFEKC 411

  Fly   410 LDYRTISKDQLKSALHA-LLKDPKYQANMMK--ASRIFRDRPLGAMDTAM 456
            ||...:..|..|...:| .||:..|:|...|  :|..||    |.:|..:
plant   412 LDKVLVQDDGKKMKCNAKKLKELAYEAVSSKGRSSENFR----GLLDAVV 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B2NP_001097859.4 egt 1..502 CDD:223071 73/310 (24%)
UDPGT 31..497 CDD:278624 73/310 (24%)
UGT78D2NP_197207.1 GT1_Gtf-like 12..438 CDD:340817 66/285 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.