DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B2 and UGT78D3

DIOPT Version :9

Sequence 1:NP_001097859.4 Gene:Ugt49B2 / 42538 FlyBaseID:FBgn0038886 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_197205.1 Gene:UGT78D3 / 831566 AraportID:AT5G17030 Length:459 Species:Arabidopsis thaliana


Alignment Length:384 Identity:89/384 - (23%)
Similarity:154/384 - (40%) Gaps:89/384 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 FALAHPEV--QELIYAKDKKG-KFDLLLVEQFHNEGALMLGYIYEIPAITIATFAYANYFSQVFG 176
            |..|.||:  :|:..|:.:.| ||..:|.:.|     |.|.      |.|.|....|::.:...|
plant    90 FLEAAPEIFRREIKAAETEVGRKFKCILTDAF-----LWLA------AETAAAEMKASWVAYYGG 143

  Fly   177 FVNPLSYVPNVFLSCTDRM-------SLWERLENVV--ISTAEDV----VREVSYYPQQDAVIRK 228
              ...|...:::   ||.:       .:.||:|..:  ||..|.:    .:|...:...|:|..|
plant   144 --GATSLTAHLY---TDAIRENVGVKEVGERMEETIGFISGMEKIRVKDTQEGVVFGNLDSVFSK 203

  Fly   229 HFSSL---LPRVPTVKQLEQNISVILLNSYMPLTSP-----RPMSQNMISVGGLHILPPKPLPEH 285
            ....:   |||.          :.:.:||:..|...     |...:..:::|.|.:|..   |..
plant   204 TLHQMGLALPRA----------TAVFINSFEELDPTFTNDFRSEFKRYLNIGPLALLSS---PSQ 255

  Fly   286 IKNYLDNAEHGAI------------YFSLGSQVRSADMPAEKLQIFLDVFASLKQRVLWKFEDDQ 338
            ... |.:..||.:            |.:.|   |.|..|..:|........|.|...:|..::.:
plant   256 TST-LVHDPHGCLAWIEKRSTASVAYIAFG---RVATPPPVELVAIAQGLESSKVPFVWSLQEMK 316

  Fly   339 LPNLPDNV--------KVEKWLPQADILAHPNVKVFIAHGGLFGMQEAVYHAVPVLGMPFYFDQD 395
            :.:||:..        .|..|.||.::|.|..:.||::|||...:.|:|...||::..|.:.|..
plant   317 MTHLPEGFLDRTREQGMVVPWAPQVELLNHEAMGVFVSHGGWNSVLESVSAGVPMICRPIFGDHA 381

  Fly   396 INIKAGQAAGYAIGLDYRTIS-----KDQLKSAL-HALLKD--PKYQANMMKASRIFRD 446
            ||.::.:|. :.||:   |||     ||..:.:| ..|::|  .|.:.|..|...:.::
plant   382 INARSVEAV-WEIGV---TISSGVFTKDGFEESLDRVLVQDDGKKMKVNAKKLEELAQE 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B2NP_001097859.4 egt 1..502 CDD:223071 89/384 (23%)
UDPGT 31..497 CDD:278624 89/384 (23%)
UGT78D3NP_197205.1 Glycosyltransferase_GTB_type 6..458 CDD:299143 89/384 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.