DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B2 and UGT76C1

DIOPT Version :9

Sequence 1:NP_001097859.4 Gene:Ugt49B2 / 42538 FlyBaseID:FBgn0038886 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_196206.1 Gene:UGT76C1 / 830472 AraportID:AT5G05870 Length:464 Species:Arabidopsis thaliana


Alignment Length:327 Identity:67/327 - (20%)
Similarity:125/327 - (38%) Gaps:86/327 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 YEIPAITIATFAYANYFSQVFGFVNPLSYVPNV----FLSCTDRMSLWERLENVVISTAEDVVRE 215
            :.:|...:..:.::.:.....        ||.:    ||...|             |.|:|:|  
plant   129 FNLPRFVLCAYKFSFFLGHFL--------VPQIRREGFLPVPD-------------SEADDLV-- 170

  Fly   216 VSYYPQQDAVIRKHFSSLLPRVPTVKQLEQNISVILLNSYMPLTSPRPMS------QNMISVGGL 274
                |:...:.:|..|.::......|.|:..: :.:|::..|.:....||      .::.....:
plant   171 ----PEFPPLRKKDLSRIMGTSAQSKPLDAYL-LKILDATKPASGIIVMSCKELDHDSLAESNKV 230

  Fly   275 HILPPKPL-PEHIKN-----------------YLDNAE-HGAIYFSLGS--QVRSADMPAEKLQI 318
            ..:|..|: |.||.:                 :||..| ...:|.||||  .:..:|        
plant   231 FSIPIFPIGPFHIHDVPASSSSLLEPDQSCIPWLDMRETRSVVYVSLGSIASLNESD-------- 287

  Fly   319 FLDVFASLK---QRVLWKFED------DQLPNLPDNV--------KVEKWLPQADILAHPNVKVF 366
            ||::...|:   |..||....      |.:.:||...        |:.:|.||.|:|||.....|
plant   288 FLEIACGLRNTNQSFLWVVRPGSVHGRDWIESLPSGFMESLDGKGKIVRWAPQLDVLAHRATGGF 352

  Fly   367 IAHGGLFGMQEAVYHAVPVLGMPFYFDQDINIK-AGQAAGYAIGLDYRTISKDQLKSALHALLKD 430
            :.|.|.....|::...||::.:|..:||.:|.: ..:.....|.|:.| |.:.:::.|:..|:.:
plant   353 LTHNGWNSTLESICEGVPMICLPCKWDQFVNARFISEVWRVGIHLEGR-IERREIERAVIRLMVE 416

  Fly   431 PK 432
            .|
plant   417 SK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B2NP_001097859.4 egt 1..502 CDD:223071 67/327 (20%)
UDPGT 31..497 CDD:278624 67/327 (20%)
UGT76C1NP_196206.1 Glycosyltransferase_GTB_type 2..451 CDD:299143 67/327 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.