DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B2 and UGT84A4

DIOPT Version :9

Sequence 1:NP_001097859.4 Gene:Ugt49B2 / 42538 FlyBaseID:FBgn0038886 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_193285.1 Gene:UGT84A4 / 827222 AraportID:AT4G15500 Length:475 Species:Arabidopsis thaliana


Alignment Length:278 Identity:66/278 - (23%)
Similarity:111/278 - (39%) Gaps:67/278 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 QVFGFVNPLSYVPNVFLSCTDRMSLWERLENVVISTAEDVVREVSYYPQQDAVIRKHFSSLLPRV 237
            ::..|::|.|.:.::..:..:::....:..:|:|.|.:::        ::|.:  .|.|.|.|:|
plant   182 EIPSFLHPSSPLSSIGGTILEQIKRLHKPFSVLIETFQEL--------EKDTI--DHMSQLCPQV 236

  Fly   238 ------------PTVK-QLEQNISVILLNSYMPLTSPRPMSQNMISVGGLHILPPKPLPEHIKNY 289
                        .|:: .::.:||....:....|.|..|.|...||.|.|..|.        :|.
plant   237 NFNPIGPLFTMAKTIRSDIKGDISKPDSDCIEWLDSREPSSVVYISFGTLAFLK--------QNQ 293

  Fly   290 LDNAEHGAIYFSLGSQVRSADMPAEKLQIFLDVFASLKQRVLWKFEDDQLP-NLPDNVKVEKWLP 353
            :|...||.:...| |.:.....|.|.|.|                |...|| .|.:..|:.:|..
plant   294 IDEIAHGILNSGL-SCLWVLRPPLEGLAI----------------EPHVLPLELEEKGKIVEWCQ 341

  Fly   354 QADILAHPNVKVFIAHGGLFGMQEAVYHAVPVLGMPFYFDQDINIKAGQAAGYAI-----GL--- 410
            |..:||||.|..|::|.|.....||:...|||:..|.:.||..|      |.|.|     ||   
plant   342 QEKVLAHPAVACFLSHCGWNSTMEALTSGVPVICFPQWGDQVTN------AVYMIDVFKTGLRLS 400

  Fly   411 ----DYRTISKDQLKSAL 424
                |.|.:.::::...|
plant   401 RGASDERIVPREEVAERL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B2NP_001097859.4 egt 1..502 CDD:223071 66/278 (24%)
UDPGT 31..497 CDD:278624 66/278 (24%)
UGT84A4NP_193285.1 PLN02555 1..475 CDD:178170 66/278 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.