DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B2 and UGT84A1

DIOPT Version :9

Sequence 1:NP_001097859.4 Gene:Ugt49B2 / 42538 FlyBaseID:FBgn0038886 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_193283.2 Gene:UGT84A1 / 827220 AraportID:AT4G15480 Length:490 Species:Arabidopsis thaliana


Alignment Length:292 Identity:55/292 - (18%)
Similarity:96/292 - (32%) Gaps:104/292 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 SYYPQQDAVI------RKHFSSLLPRVPTVKQLE----------------------QNIS---VI 250
            :||..||..:      .......||.||.:|..|                      :|:|   .:
plant   163 AYYHYQDGSVSFPTETEPELDVKLPCVPVLKNDEIPSFLHPSSRFTGFRQAILGQFKNLSKSFCV 227

  Fly   251 LLNSYMPLTSPRPMSQNMISVGGLHILPPKPLPEHIK---------------------NYLDN-A 293
            |::|:..|      .|.:|.... .:.|.|.:....|                     .:||: .
plant   228 LIDSFDSL------EQEVIDYMS-SLCPVKTVGPLFKVARTVTSDVSGDICKSTDKCLEWLDSRP 285

  Fly   294 EHGAIYFSLGSQVRSADMPAEKLQIFLDVFASLKQRVLWKFEDDQLPNLPDNVKVE--------- 349
            :...:|.|.|:   .|.:..|:::.............||.....     |.::|||         
plant   286 KSSVVYISFGT---VAYLKQEQIEEIAHGVLKSGLSFLWVIRPP-----PHDLKVETHVLPQELK 342

  Fly   350 -----------KWLPQADILAHPNVKVFIAHGGLFGMQEAVYHAVPVLGMPFYFDQ--------D 395
                       .|.||..:|:||:|..|:.|.|.....|::...|||:..|.:.||        |
plant   343 ESSAKGKGMIVDWCPQEQVLSHPSVACFVTHCGWNSTMESLSSGVPVVCCPQWGDQVTDAVYLID 407

  Fly   396 I---NIKAGQAAGYAIGLDYRTISKDQLKSAL 424
            :   .::.|:.|     .:.|.:.::::...|
plant   408 VFKTGVRLGRGA-----TEERVVPREEVAEKL 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B2NP_001097859.4 egt 1..502 CDD:223071 55/292 (19%)
UDPGT 31..497 CDD:278624 55/292 (19%)
UGT84A1NP_193283.2 PLN02555 17..490 CDD:178170 55/292 (19%)
YjiC 19..477 CDD:224732 55/292 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.