DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B2 and AT3G46650

DIOPT Version :9

Sequence 1:NP_001097859.4 Gene:Ugt49B2 / 42538 FlyBaseID:FBgn0038886 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_190249.4 Gene:AT3G46650 / 823818 AraportID:AT3G46650 Length:435 Species:Arabidopsis thaliana


Alignment Length:428 Identity:86/428 - (20%)
Similarity:160/428 - (37%) Gaps:129/428 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ILAPFFLPVKSHFMMTDAIIRELVKRGHEVTFI----TPLSLAKENLGPNYREILLPKYDTWADI 81
            :|.|  :|.:.|......:.:.|..:|..:|.:    ..:|.:.::. |.::.:.:         
plant    12 VLVP--IPAQGHVTPLMQLGKVLNSKGFSITVVEGHFNQVSSSSQHF-PGFQFVTI--------- 64

  Fly    82 SAMMKTKSALDMIDMSKLTHMRLAQHIGIKSTDFALAHPEVQELIYAKDKKGKF----DLLLVEQ 142
                  |.:|...:..||.        ||:|.           :...|..:..|    ..||::|
plant    65 ------KESLPESEFEKLG--------GIESM-----------ITLNKTSEASFKDCISQLLLQQ 104

  Fly   143 FHNEGALMLG-YIY---------EIPAITIATFAYANYFS------QVFGFVNPLSY--VPNVFL 189
            .::...::.. |:|         .||::..:|.:.|||.|      :|...:.||.|  :|...:
plant   105 GNDIACIIYDEYMYFCGAAAKEFSIPSVIFSTQSAANYVSHPDMQDKVVENLYPLRYKDLPTSGM 169

  Fly   190 SCTDRMSLWERLENVVISTAEDVVREVSYYPQQDAVIRKHFSSLLPRVPTVKQLEQNISVILLNS 254
            ...||..              ::.|||:......|||....|.|  ...::..|||.:.:    |
plant   170 GPLDRFF--------------ELCREVANKRTASAVIINTVSCL--ESSSLSWLEQKVGI----S 214

  Fly   255 YMPLTSPRPMSQNMISVGGLHIL--PPKPLPEHIKNYLD----NAEHGAIYFSLGS--QVRSADM 311
            ..||             |.||:.  .|..|.|..::.::    ......||.|:|:  |:.:.::
plant   215 VYPL-------------GPLHMTDSSPSSLLEEDRSCIEWLNKQKPKSVIYISIGTLGQMETKEV 266

  Fly   312 PAEKLQIFLDV---FASLKQRVLWKFE------DDQLPNLPDNVK--------VEKWLPQADILA 359
                    |::   ..:..|..||...      .:.:.:||::|.        :.|..||.::|.
plant   267 --------LEMSWGLCNSNQPFLWVIRAGSILGTNGIESLPEDVNKMVSERGYIVKRAPQIEVLG 323

  Fly   360 HPNVKVFIAHGGLFGMQEAVYHAVPVLGMPFYFDQDIN 397
            ||.|..|.:|.|...:.|::...||::..||:.:|.:|
plant   324 HPAVGGFWSHCGWNSILESIGEGVPMICKPFHGEQKLN 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B2NP_001097859.4 egt 1..502 CDD:223071 86/428 (20%)
UDPGT 31..497 CDD:278624 83/418 (20%)
AT3G46650NP_190249.4 Glycosyltransferase_GTB-type 1..435 CDD:385653 86/428 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.