DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B2 and HYR1

DIOPT Version :9

Sequence 1:NP_001097859.4 Gene:Ugt49B2 / 42538 FlyBaseID:FBgn0038886 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_188813.1 Gene:HYR1 / 821730 AraportID:AT3G21760 Length:485 Species:Arabidopsis thaliana


Alignment Length:520 Identity:90/520 - (17%)
Similarity:170/520 - (32%) Gaps:172/520 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MKLLFVCLLGTGDGARILAPFFLPVK------SHFMMTDAIIREL--VKRGHEVTFITPLSL-AK 60
            |||..|.:...|||.  |.|.....|      .|..:|..||.::  ....:..::|..||. ::
plant     1 MKLELVFIPSPGDGH--LRPLVEVAKLHVDRDDHLSITIIIIPQMHGFSSSNSSSYIASLSSDSE 63

  Fly    61 ENLGPNYREI--------LLPKYDTWAD-----ISAMMK-----------TKSALDMIDMSKLTH 101
            |.|..|...:        ..|.:..:.|     :.|.::           ::.|..::||..:..
plant    64 ERLSYNVLSVPDKPDSDDTKPHFFDYIDNFKPQVKATVEKLTDPGPPDSPSRLAGFVVDMFCMMM 128

  Fly   102 MRLAQHIGIKSTDFALAHPEVQELIYAKDKKGKFDLLLVEQFHNEGALMLG------YIY----- 155
            :.:|...|:.|                            ..|:...|..||      |:|     
plant   129 IDVANEFGVPS----------------------------YMFYTSNATFLGLQVHVEYLYDVKNY 165

  Fly   156 -------------EIPAITIATFAYANYFSQVFGFVNPLSYVPNVFLSCTDRMSLWERLENVVIS 207
                         |:|.:|...               |:...|:|.|:     ..|..:      
plant   166 DVSDLKDSDTTELEVPCLTRPL---------------PVKCFPSVLLT-----KEWLPV------ 204

  Fly   208 TAEDVVREVSYYPQQDAVIRKHFSSLLPRVPTVKQLEQNISVILLNSYMPLTSPRPMSQNMISVG 272
                :.|:...:.:...::...|:.|.|:.              :..:..:.||.|....:..|.
plant   205 ----MFRQTRRFRETKGILVNTFAELEPQA--------------MKFFSGVDSPLPTVYTVGPVM 251

  Fly   273 GLHILPPKPLPE---HIKNYLDNAEHGAIYF-SLGSQVRSADMPAEKLQIFLDVFASLKQRVLWK 333
            .|.|..|....:   .|..:||.....::.| ..||.....:..|:::.|.|:   ....|.:|.
plant   252 NLKINGPNSSDDKQSEILRWLDEQPRKSVVFLCFGSMGGFREGQAKEIAIALE---RSGHRFVWS 313

  Fly   334 FE----------DDQLPNLPDNV------------KVEKWLPQADILAHPNVKVFIAHGGLFGMQ 376
            ..          .::..||.:.:            |:..|.||:.|||:|.:..|::|.|.....
plant   314 LRRAQPKGSIGPPEEFTNLEEILPEGFLERTAEIGKIVGWAPQSAILANPAIGGFVSHCGWNSTL 378

  Fly   377 EAVYHAVPVLGMPFYFDQDINI-----KAGQAA-------GYAIGLDYRTISKDQLKSALHALLK 429
            |:::..||:...|.|.:|.:|.     :.|.|.       |..:..|...::.::::..:..|::
plant   379 ESLWFGVPMATWPLYAEQQVNAFEMVEELGLAVEVRNSFRGDFMAADDELMTAEEIERGIRCLME 443

  Fly   430  429
            plant   444  443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B2NP_001097859.4 egt 1..502 CDD:223071 90/520 (17%)
UDPGT 31..497 CDD:278624 80/488 (16%)
HYR1NP_188813.1 PLN02554 1..485 CDD:215304 90/520 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.