DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B2 and AT2G30150

DIOPT Version :9

Sequence 1:NP_001097859.4 Gene:Ugt49B2 / 42538 FlyBaseID:FBgn0038886 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001323694.1 Gene:AT2G30150 / 817567 AraportID:AT2G30150 Length:456 Species:Arabidopsis thaliana


Alignment Length:328 Identity:64/328 - (19%)
Similarity:108/328 - (32%) Gaps:107/328 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 IPAITIATFAYANYFSQVFGFVNP-LSYVPNVFLSCTDRMS------------LWERLENVVIST 208
            :|.|..:....||.|   ..|::. |:.:...|....||::            :|.    |.:.|
plant    70 LPNIIPSELVRANDF---IAFIDAVLTRLEEPFEQLLDRLNSPPTAIIADTYIIWA----VRVGT 127

  Fly   209 AEDVVREVSYYPQQDAVIRKHF--SSLL------PRVPTVKQLEQNISVILLNSYMPLTSPRPMS 265
            ..::  .|:.:....|.|...|  |.||      |..|:..:|::.:      .|:|..||..:|
plant   128 KRNI--PVASFWTTSATILSLFINSDLLASHGHFPIEPSESKLDEIV------DYIPGLSPTRLS 184

  Fly   266 QNMISVGGLH-------------------------ILPPK--------------------PLPE- 284
            ...|..|..|                         .|.||                    ||.| 
plant   185 DLQILHGYSHQVFNIFKKSFGELYKAKYLLFPSAYELEPKAIDFFTSKFDFPVYSTGPLIPLEEL 249

  Fly   285 ----------HIKNYLDNAEHGAIYFSLGSQVRSADMPAEKLQIFLDVFASLKQ---RVLWKFED 336
                      :.|...:..|...:|.|.||.:..::...|      ::...:::   :..|....
plant   250 SVGNENRELDYFKWLDEQPESSVLYISQGSFLSVSEAQME------EIVVGVREAGVKFFWVARG 308

  Fly   337 DQLPNLPDNVK-----VEKWLPQADILAHPNVKVFIAHGGLFGMQEAVYHAVPVLGMPFYFDQDI 396
            .:| .|.:.::     |..|..|..:|.|..:..|..|.|.....|.:...||:|..|.::||.:
plant   309 GEL-KLKEALEGSLGVVVSWCDQLRVLCHAAIGGFWTHCGYNSTLEGICSGVPLLTFPVFWDQFL 372

  Fly   397 NIK 399
            |.|
plant   373 NAK 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B2NP_001097859.4 egt 1..502 CDD:223071 64/328 (20%)
UDPGT 31..497 CDD:278624 64/328 (20%)
AT2G30150NP_001323694.1 PLN02448 11..456 CDD:215247 64/328 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.