DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B2 and UGT76D1

DIOPT Version :9

Sequence 1:NP_001097859.4 Gene:Ugt49B2 / 42538 FlyBaseID:FBgn0038886 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_180216.1 Gene:UGT76D1 / 817189 AraportID:AT2G26480 Length:452 Species:Arabidopsis thaliana


Alignment Length:344 Identity:74/344 - (21%)
Similarity:122/344 - (35%) Gaps:107/344 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 SLWERLENVVISTAEDVV-----REVSYYPQQDA-----------------------VIRKHFSS 232
            |:.|.|....::..:|||     .|..|:|::.|                       ::....:.
plant    84 SVCEPLLKEFLTNHDDVVDFIIYDEFVYFPRRVAEDMNLPKMVFSPSSAATSISRCVLMENQSNG 148

  Fly   233 LLPRVPTVKQLEQNISVILLNSY--MPLTSPRPMSQNMI----------SVGGLH---------- 275
            |||......|||:.:.......:  :|.|:...|.:.||          |.|.:|          
plant   149 LLPPQDARSQLEETVPEFHPFRFKDLPFTAYGSMERLMILYENVSNRASSSGIIHNSSDCLENSF 213

  Fly   276 -----------ILPPKPLPEHIKN-----------------YLDNAE-HGAIYFSLGSQVRSADM 311
                       :.|..||  |:.|                 :|:..| ...||.|:||...:.|:
plant   214 ITTAQEKWGVPVYPVGPL--HMTNSAMSCPSLFEEERNCLEWLEKQETSSVIYISMGSLAMTQDI 276

  Fly   312 PAEKLQIFLDVFASLKQRVLWKFE------DDQLPNLPDNVK---------VEKWLPQADILAHP 361
            .|.::.:   .|....|..||...      .:.|..||:...         |.||.||.::|.|.
plant   277 EAVEMAM---GFVQSNQPFLWVIRPGSINGQESLDFLPEQFNQTVTDGRGFVVKWAPQKEVLRHR 338

  Fly   362 NVKVFIAHGGLFGMQEAVYHAVPVLGMPFYFDQDINIK----AGQAAGYAIGLDYRTISKDQLKS 422
            .|..|..|||.....|::...||::..|:..||.:|.:    ..|.| |.|..:   :.:..::.
plant   339 AVGGFWNHGGWNSCLESISSGVPMICRPYSGDQRVNTRLMSHVWQTA-YEIEGE---LERGAVEM 399

  Fly   423 ALHALLKDPKYQANMMKAS 441
            |:..|:.|.:.|...|:|:
plant   400 AVRRLIVDQEGQEMRMRAT 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B2NP_001097859.4 egt 1..502 CDD:223071 74/344 (22%)
UDPGT 31..497 CDD:278624 74/344 (22%)
UGT76D1NP_180216.1 Glycosyltransferase_GTB-type 6..445 CDD:415824 74/344 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.