DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B2 and AT2G18570

DIOPT Version :9

Sequence 1:NP_001097859.4 Gene:Ugt49B2 / 42538 FlyBaseID:FBgn0038886 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_849978.2 Gene:AT2G18570 / 816372 AraportID:AT2G18570 Length:470 Species:Arabidopsis thaliana


Alignment Length:406 Identity:77/406 - (18%)
Similarity:150/406 - (36%) Gaps:108/406 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 EQFHNEGALMLGYIYEIPAITIATFAY--ANYFSQVFGFVNPLSYVPNVFLSCTDRMSLWERLEN 203
            |..|...|..:..|.|||::.:.....  |..|:::  .|...:..|.|    .|.:.|.:|...
plant    51 EAIHAAAARTICQITEIPSVDVDNLVEPDATIFTKM--VVKMRAMKPAV----RDAVKLMKRKPT 109

  Fly   204 VVI---------STAEDV---------------VREVSYYPQQDAVIRKHFSSL-----LPRVPT 239
            |:|         |.|:||               :..:.|.|..|.|:...:..:     :|....
plant   110 VMIVDFLGTELMSVADDVGMTAKYVYVPTHAWFLAVMVYLPVLDTVVEGEYVDIKEPLKIPGCKP 174

  Fly   240 V--KQLEQNI---------------------SVILLNSYMPL----TSPRPMSQNMISVGGLHIL 277
            |  |:|.:.:                     ..:|:|::..|    .:.....:.:..|..:.:.
plant   175 VGPKELMETMLDRSGQQYKECVRAGLEVPMSDGVLVNTWEELQGNTLAALREDEELSRVMKVPVY 239

  Fly   278 PPKPL---------PEHIKNYLD-NAEHGAIYFSLGSQVRSADMPAEKLQIFLDVFASLKQRVLW 332
            |..|:         |..|..:|| ..|...::..|||..........:|.:.|::..   ||.:|
plant   240 PIGPIVRTNQHVDKPNSIFEWLDEQRERSVVFVCLGSGGTLTFEQTVELALGLELSG---QRFVW 301

  Fly   333 ------------KFEDDQL-PNLPD---------NVKVEKWLPQADILAHPNVKVFIAHGGLFGM 375
                        ..:|:|: .:||:         .:.|.:|.||.:||:|.::..|::|.|....
plant   302 VLRRPASYLGAISSDDEQVSASLPEGFLDRTRGVGIVVTQWAPQVEILSHRSIGGFLSHCGWSSA 366

  Fly   376 QEAVYHAVPVLGMPFYFDQDINIK-AGQAAGYAIGL----DYRTISKDQLKSALHALLKDPKYQA 435
            .|::...||::..|.|.:|.:|.. ..:..|.|:..    ..|.|.::::.|.:..::.:...:.
plant   367 LESLTKGVPIIAWPLYAEQWMNATLLTEEIGVAVRTSELPSERVIGREEVASLVRKIMAEEDEEG 431

  Fly   436 NMMKAS----RIFRDR 447
            ..::|.    |:..:|
plant   432 QKIRAKAEEVRVSSER 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B2NP_001097859.4 egt 1..502 CDD:223071 77/406 (19%)
UDPGT 31..497 CDD:278624 77/406 (19%)
AT2G18570NP_849978.2 PLN03015 1..470 CDD:178589 77/406 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.