DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B2 and AT2G18560

DIOPT Version :9

Sequence 1:NP_001097859.4 Gene:Ugt49B2 / 42538 FlyBaseID:FBgn0038886 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_179446.2 Gene:AT2G18560 / 816371 AraportID:AT2G18560 Length:380 Species:Arabidopsis thaliana


Alignment Length:289 Identity:62/289 - (21%)
Similarity:113/289 - (39%) Gaps:73/289 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 PQQDAVIRKHFSSLLPRVPTVKQLEQNISVILLNSYMPLTSPRPMSQNMISVGGL---HILPPKP 281
            |..|.|:...:..|..:  |:..|.::|.   ||        |.:...:..:|.:   ::|..| 
plant   113 PMSDGVLVNTWGELQGK--TLAALREDID---LN--------RVIKVPVYPIGPIVRTNVLIEK- 163

  Fly   282 LPEHIKNYLD-NAEHGAIYFSLGSQVRSADMPAEKLQIFLDVFASLKQRVLWKF----------- 334
             |.....:|| ..|...:|..|||....:.....:|...|::..   |..||..           
plant   164 -PNSTFEWLDKQEERSVVYVCLGSGGTLSFEQTMELAWGLELSC---QSFLWVLRKPPSYLGASS 224

  Fly   335 -EDDQLPN-LPD---------NVKVEKWLPQADILAHPNVKVFIAHGGLFGMQEAVYHAVPVLGM 388
             :|||:.: ||:         .:.|.:|.||.:||:|.::..|::|.|...:.|::...||::..
plant   225 KDDDQVSDGLPEGFLDRTRGVGLVVTQWAPQVEILSHRSIGGFLSHCGWSSVLESLTKGVPIIAW 289

  Fly   389 PFYFDQDINIKAGQAAGYAIGLDYRT--------ISKDQLKSALHALLKDPKYQANMMKAS---- 441
            |.|.:|.:|   .......||:..||        ||::::.|.:..::.:...:...:|..    
plant   290 PLYAEQWMN---ATLLTEEIGMAIRTSELPSKKVISREEVASLVKKIVAEEDKEGRKIKTKAEEV 351

  Fly   442 RIFRDRPLGAMDTAMYWINYVVEHRGAPH 470
            |:..:|.         |     .|.|:.|
plant   352 RVSSERA---------W-----THGGSSH 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B2NP_001097859.4 egt 1..502 CDD:223071 62/289 (21%)
UDPGT 31..497 CDD:278624 62/289 (21%)
AT2G18560NP_179446.2 Glycosyltransferase_GTB_type 1..380 CDD:299143 62/289 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.