DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B2 and AT2G16890

DIOPT Version :9

Sequence 1:NP_001097859.4 Gene:Ugt49B2 / 42538 FlyBaseID:FBgn0038886 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_179281.3 Gene:AT2G16890 / 816190 AraportID:AT2G16890 Length:478 Species:Arabidopsis thaliana


Alignment Length:390 Identity:84/390 - (21%)
Similarity:140/390 - (35%) Gaps:129/390 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 EIPAITI-ATFAYANYFSQVFGFVNPLSYVPNVFLSCTDRMSLWERLENVVISTAE-----DVVR 214
            ::|:::: ..|..|....|.| |...|..:|.|....:|....|         |:|     ::.|
plant    88 KLPSMSLFVPFTRATKLLQPF-FEETLKTLPKVSFMVSDGFLWW---------TSESAAKFNIPR 142

  Fly   215 EVSY----YPQQDAV-IRKH--FSS----------LLPRVPTVK------------------QLE 244
            .|||    |....:: :.||  |:.          .:|..|.:|                  .||
plant   143 FVSYGMNSYSAAVSISVFKHELFTEPESKSDTEPVTVPDFPWIKVKKCDFDHGTTEPEESGAALE 207

  Fly   245 QNISVI---------LLNSYMPLTS----------PRPMSQNMISVGGLHILPP------KPLPE 284
            .::..|         |:||:..|.|          .:|.|.   .||.|.:..|      ||...
plant   208 LSMDQIKSTTTSHGFLVNSFYELESAFVDYNNNSGDKPKSW---CVGPLCLTDPPKQGSAKPAWI 269

  Fly   285 HIKNYLD-NAEHG--AIYFSLGSQVRSADMPAEKLQIFLDVFASLKQRVLWKFEDDQL----PNL 342
            |   :|| ..|.|  .:|.:.|:|...::....:|...|:   ..|...||....|..    ...
plant   270 H---WLDQKREEGRPVLYVAFGTQAEISNKQLMELAFGLE---DSKVNFLWVTRKDVEEIIGEGF 328

  Fly   343 PDNVK-----VEKWLPQADILAHPNVKVFIAHGGLFGMQEAVYHAVPVLGMPFYFDQDINIKA-- 400
            .|.::     |..|:.|.:||:|.:||.|::|.|....||::...||:|..|...:|.:|.|.  
plant   329 NDRIRESGMIVRDWVDQWEILSHESVKGFLSHCGWNSAQESICVGVPLLAWPMMAEQPLNAKMVV 393

  Fly   401 -------------GQAAGYAIGLDYRTISKDQLKSALHALL---------KDPKYQANMMKASRI 443
                         |...|:        :::::|...:..|:         |:.|..:.|.||:.:
plant   394 EEIKVGVRVETEDGSVKGF--------VTREELSGKIKELMEGETGKTARKNVKEYSKMAKAALV 450

  Fly   444  443
            plant   451  450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B2NP_001097859.4 egt 1..502 CDD:223071 84/390 (22%)
UDPGT 31..497 CDD:278624 84/390 (22%)
AT2G16890NP_179281.3 Glycosyltransferase_GTB_type 9..467 CDD:299143 84/390 (22%)
YjiC 9..440 CDD:224732 80/378 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.