DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and ISX

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001290437.1 Gene:ISX / 91464 HGNCID:28084 Length:245 Species:Homo sapiens


Alignment Length:212 Identity:63/212 - (29%)
Similarity:84/212 - (39%) Gaps:40/212 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 SDCDSPP-PLSSSPSESPLSHDGSGLSR------------KKRSRAAFSHAQVFELERRFAQQRY 199
            ||.|.|. |....|.|:..|  ||||.:            |:|.|..|:..|:.|||:.|....|
Human    44 SDMDRPEGPGEEGPGEAAAS--GSGLEKPPKDQPQEGRKSKRRVRTTFTTEQLHELEKIFHFTHY 106

  Fly   200 LSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYA 264
            .....||::|..:.|.|.:|:|||||:|.|.::    |.:...|||    |.|:........|..
Human   107 PDVHIRSQLAARINLPEARVQIWFQNQRAKWRK----QEKIGNLGA----PQQLSEASVALPTNL 163

  Fly   265 HMAAP----GAGHGLDPALINIYRHQLQLAYGGLPL--------PQMQMPFPYFYPQHKVPQPI- 316
            .:|.|    .|...|.|........|.|||....|.        |....|.|.. |.|:...|: 
Human   164 DVAGPTWTSTALRRLAPPTSCCPSAQDQLASAWFPAWITLLPAHPWETQPVPGL-PIHQTCIPVL 227

  Fly   317 ---PPPTQSSSFVTASS 330
               |||......:.|:|
Human   228 CILPPPHPKWGSICATS 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 21/52 (40%)
ISXNP_001290437.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..86 14/43 (33%)
Homeobox 86..138 CDD:278475 21/51 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.