DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and BARX2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_003649.2 Gene:BARX2 / 8538 HGNCID:956 Length:279 Species:Homo sapiens


Alignment Length:323 Identity:78/323 - (24%)
Similarity:123/323 - (38%) Gaps:95/323 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RMSSVDSEPEPEKLKPSSDRERS------ISKSPPLCCRDLGLYK-----LTQPKEI-----QPS 87
            |:||      |.:||.:..|.::      :||........|.||.     :.:||.:     .||
Human     8 RLSS------PGQLKAARRRYKTFMIDEILSKETCDYFEKLSLYSVCPSLVVRPKPLHSCTGSPS 66

  Fly    88 ----------ARQPS--NYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDM 140
                      .|||:  ::|......:......||.|...::.|..         |..||     
Human    67 LRAYPLLSVITRQPTVISHLVPATPGIAQALSCHQVTEAVSAEAPG---------GEALA----- 117

  Fly   141 RRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPER 205
                |::|:.:.|.|....|               :|||..|:..|:..||::|.:|:|||.|:|
Human   118 ----SSESETEQPTPRQKKP---------------RRSRTIFTELQLMGLEKKFQKQKYLSTPDR 163

  Fly   206 SEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPG 270
            .::|:||.||:.|||.|:||||.|.|:..::..:.|......|.....:...:.......|.:..
Human   164 LDLAQSLGLTQLQVKTWYQNRRMKWKKMVLKGGQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQA 228

  Fly   271 AGHGLDPALINIYRHQLQLAYG-------------GLPLPQMQMPFPYFYPQH-KVPQPIPPP 319
            .|           :.||:.:.|             .:||...:.|.|   ||. .:|...|||
Human   229 QG-----------QEQLEPSQGQEELCEAQEPKARDVPLEMAEPPDP---PQELPIPSSEPPP 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 27/52 (52%)
BARX2NP_003649.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..137 10/59 (17%)
Homeobox 136..189 CDD:306543 27/52 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..279 17/98 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.