DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and HDG11

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_177479.1 Gene:HDG11 / 843671 AraportID:AT1G73360 Length:722 Species:Arabidopsis thaliana


Alignment Length:213 Identity:52/213 - (24%)
Similarity:85/213 - (39%) Gaps:37/213 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 HDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTK 231
            ||||...|||:.....:..|:..||..|.:..:....:|:::::.|.|...|:|.||||||.:.|
plant    24 HDGSETDRKKKRYHRHTAQQIQRLESSFKECPHPDEKQRNQLSRELGLAPRQIKFWFQNRRTQLK 88

  Fly   232 RKQIQQHEAALLGASKRVPVQ-VLVREDGSTTYAHMAAPGAGH---GLDP-------ALINIY-R 284
            .:..:...:||...:.::..: :.:||    ...|...|..|.   ..||       .:.|.: |
plant    89 AQHERADNSALKAENDKIRCENIAIRE----ALKHAICPNCGGPPVSEDPYFDEQKLRIENAHLR 149

  Fly   285 HQLQ------LAYGGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPVPIP---I 340
            .:|:      ..|.|.|:.|:..    .:|.|     |.|...|.:.:|..........:.   :
plant   150 EELERMSTIASKYMGRPISQLST----LHPMH-----ISPLDLSMTSLTGCGPFGHGPSLDFDLL 205

  Fly   341 PG---AVRPQRTPCPSPN 355
            ||   ||.|.......||
plant   206 PGSSMAVGPNNNLQSQPN 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 15/52 (29%)
HDG11NP_177479.1 Homeobox 35..88 CDD:278475 15/52 (29%)
START_ArGLABRA2_like 231..456 CDD:176884
SRPBCC 517..>562 CDD:301327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.