DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and HAT2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_199548.1 Gene:HAT2 / 834784 AraportID:AT5G47370 Length:283 Species:Arabidopsis thaliana


Alignment Length:243 Identity:56/243 - (23%)
Similarity:95/243 - (39%) Gaps:63/243 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLNMESAGVSAAMAGLSKSLTTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSD-RERSISK 64
            |:..|..|:|.:: |.|:: ..|..:|     .||.:...:::...|..:...|:|| |:..::.
plant     2 MMGKEDLGLSLSL-GFSQN-HNPLQMN-----LNPNSSLSNNLQRLPWNQTFDPTSDLRKIDVNS 59

  Fly    65 SPPL--CCRDLGLYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKL 127
            .|..  |..|.|:             ..|::.:....:...:.......||..:....|.:....
plant    60 FPSTVNCEEDTGV-------------SSPNSTISSTISGKRSEREGISGTGVGSGDDHDEITPDR 111

  Fly   128 AYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKK----RSRAAFSHAQVF 188
            .|           .|.||::.:                  ||...||||    :.::||      
plant   112 GY-----------SRGTSDEEE------------------DGGETSRKKLRLSKDQSAF------ 141

  Fly   189 ELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQ 236
             ||..|.:...|:..::..:||.|.||..||::||||||.:||.||.:
plant   142 -LEETFKEHNTLNPKQKLALAKKLNLTARQVEVWFQNRRARTKLKQTE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 19/52 (37%)
HAT2NP_199548.1 HD-ZIP_N 8..91 CDD:398351 18/102 (18%)
HOX 129..183 CDD:197696 22/60 (37%)
HALZ 185..228 CDD:128634 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.