DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and HB-3

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_568309.2 Gene:HB-3 / 831367 AraportID:AT5G15150 Length:314 Species:Arabidopsis thaliana


Alignment Length:201 Identity:53/201 - (26%)
Similarity:84/201 - (41%) Gaps:41/201 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 MDNNNHHHQATGTSNSSAADY----------MQRKLAYFGSTLAAPLDMRRCTS----NDSDCDS 152
            :..:|.||..:.||..|...:          |.|.:::.|.:....|..:..|:    ||.|   
plant    34 LHEDNAHHLPSPTSLPSCPPHLFYGGGGNYMMNRSMSFTGVSDHHHLTQKSPTTTNNMNDQD--- 95

  Fly   153 PPPLSSSPSESPLSHDGSGL---SRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRL 214
                 ....|..||.|||.:   .:|||    .:..||..||:.|.....|....:.::||:|.|
plant    96 -----QVGEEDNLSDDGSHMMLGEKKKR----LNLEQVRALEKSFELGNKLEPERKMQLAKALGL 151

  Fly   215 TETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDPAL 279
            ...|:.|||||||.:.|.||:::...:|   .|:..|   ::.|..:..||      ...|...|
plant   152 QPRQIAIWFQNRRARWKTKQLERDYDSL---KKQFDV---LKSDNDSLLAH------NKKLHAEL 204

  Fly   280 INIYRH 285
            :.:.:|
plant   205 VALKKH 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 18/52 (35%)
HB-3NP_568309.2 HOX 115..168 CDD:197696 21/56 (38%)
HALZ 170..208 CDD:280364 10/49 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.