DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and HB-2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_193411.1 Gene:HB-2 / 827384 AraportID:AT4G16780 Length:284 Species:Arabidopsis thaliana


Alignment Length:245 Identity:58/245 - (23%)
Similarity:95/245 - (38%) Gaps:68/245 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 DLGL-YKLTQPKE-----------IQPSAR-----QPSNYLQYYAAAMDNNNHHHQATGT----- 114
            |||| ..|..||:           :.||:.     :.|::.:.:.:::.|::...:.|.|     
plant     7 DLGLSLGLNFPKKQINLKSNPSVSVTPSSSSFGLFRRSSWNESFTSSVPNSDSSQKETRTFIRGI 71

  Fly   115 ---SNSSAADYMQRK--LAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSR 174
               ...|.|:|....  ::...||:::....|.....|:|     |..|    ..:|.|..|.:.
plant    72 DVNRPPSTAEYGDEDAGVSSPNSTVSSSTGKRSEREEDTD-----PQGS----RGISDDEDGDNS 127

  Fly   175 KKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQ--- 236
            :|:.|.:...:.:  ||..|.....|:..::..:||.|.|...||::||||||.:||.||.:   
plant   128 RKKLRLSKDQSAI--LEETFKDHSTLNPKQKQALAKQLGLRARQVEVWFQNRRARTKLKQTEVDC 190

  Fly   237 -----------------QHEAALLGASKRVPVQVLVREDGSTTYAHMAAP 269
                             |.|...|.|.|..|          ..|.||:.|
plant   191 EFLRRCCENLTEENRRLQKEVTELRALKLSP----------QFYMHMSPP 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 17/52 (33%)
HB-2NP_193411.1 HD-ZIP_N 8..107 CDD:282474 18/98 (18%)
HOX 128..182 CDD:197696 18/55 (33%)
HALZ 184..227 CDD:128634 9/52 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.