DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and HB20

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_186771.1 Gene:HB20 / 821232 AraportID:AT3G01220 Length:286 Species:Arabidopsis thaliana


Alignment Length:110 Identity:32/110 - (29%)
Similarity:53/110 - (48%) Gaps:21/110 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 ESPLSHDGSGL---SRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWF 223
            |..||.||:..   .:|||.:.    .||..||:.|.....|....:.::||:|.:...|:.|||
plant    72 EENLSDDGAHTMLGEKKKRLQL----EQVKALEKSFELGNKLEPERKIQLAKALGMQPRQIAIWF 132

  Fly   224 QNRRYKTKRKQIQQ--------------HEAALLGASKRVPVQVL 254
            ||||.:.|.:|:::              ..|:||..:|::..:|:
plant   133 QNRRARWKTRQLERDYDSLKKQFESLKSDNASLLAYNKKLLAEVM 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 17/52 (33%)
HB20NP_186771.1 HOX 87..140 CDD:197696 20/56 (36%)
HALZ 142..183 CDD:280364 6/36 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.