DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and nkx2.1

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_571851.1 Gene:nkx2.1 / 81883 ZFINID:ZDB-GENE-010404-1 Length:346 Species:Danio rerio


Alignment Length:318 Identity:95/318 - (29%)
Similarity:126/318 - (39%) Gaps:94/318 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LSKSLTTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQ 80
            :|...|||||::|||:               |..|..|..|....::  ..||.           
Zfish     3 MSPKHTTPFSVSDILS---------------PLEESYKKVSMEGNNL--GAPLA----------- 39

  Fly    81 PKEIQPSARQPSNYLQYYAAAMDNNN----------HHHQATGT---SNSSAADYMQRKLAYFGS 132
                  |.|||    |...|||..::          :|..|.|.   |:::...|....|.....
Zfish    40 ------SYRQP----QVTQAAMQQHHMGHNGTVPAAYHMTAAGVSQLSHTAMGGYCNGNLGNMSD 94

  Fly   133 TLAAPLDMRRCTSNDSDCDSPPP-----------------LSSSPSESPLSHDGSGLS------R 174
            ..|....||..|:..|...:.|.                 :.|..:.|.|:..|.|:.      |
Zfish    95 LPAYQDGMRGSTTATSWYGTNPDPRFSTISRFMGSSSGMNMGSMSTLSSLADVGKGMGPLTSTPR 159

  Fly   175 KKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKR------- 232
            :|| |..||.|||:||||||.||:|||.|||..:|..:.||.|||||||||.|||.||       
Zfish   160 RKR-RVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKVS 223

  Fly   233 -KQIQQHEAAL---LGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDPALINIYRHQ 286
             :|:||...:.   ..:.:||.|.|||: ||.........|..|       :..:.||
Zfish   224 QQQMQQDNGSCQQQQQSPRRVAVPVLVK-DGKPCQGSSHTPNTG-------VQNHHHQ 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 35/52 (67%)
nkx2.1NP_571851.1 Homeobox 162..215 CDD:278475 36/53 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.