DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and HB6

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_565536.1 Gene:HB6 / 816775 AraportID:AT2G22430 Length:311 Species:Arabidopsis thaliana


Alignment Length:289 Identity:64/289 - (22%)
Similarity:95/289 - (32%) Gaps:111/289 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 MRRCTSNDS--DCDSPPPLSSSPSESPLSHDGS-----------------------GLSRKKRSR 179
            |:|.:|:||  ...|..|.:|:..:||..:.|.                       |||.|||  
plant     2 MKRLSSSDSVGGLISLCPTTSTDEQSPRRYGGREFQSMLEGYEEEEEAIVEERGHVGLSEKKR-- 64

  Fly   180 AAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLG 244
             ..|..||..||:.|..:..|....:.::|:.|.|...||.:||||||.:.|.||:::....|  
plant    65 -RLSINQVKALEKNFELENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLEKDYGVL-- 126

  Fly   245 ASKRVPVQVLVREDGSTTYAHMAAPGAGHGLD-------PALINIYRHQLQLAYGG--------- 293
                           .|.|..:.     |..|       ..|..|.:.:.:|..||         
plant   127 ---------------KTQYDSLR-----HNFDSLRRDNESLLQEISKLKTKLNGGGGEEEEEENN 171

  Fly   294 ---------------LPLPQMQMPFPYFYPQ---HK----------VPQPIPPPTQSSSFVTASS 330
                           :.||:.....|...||   |.          :...:|....:|||..|:.
plant   172 AAVTTESDISVKEEEVSLPEKITEAPSSPPQFLEHSDGLNYRSFTDLRDLLPLKAAASSFAAAAG 236

  Fly   331 ASSS-----------------PVPIPIPG 342
            :|.|                 ..|:.:||
plant   237 SSDSSDSSALLNEESSSNVTVAAPVTVPG 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 18/52 (35%)
HB6NP_565536.1 Homeobox 62..115 CDD:278475 21/55 (38%)
HALZ 117..158 CDD:280364 9/62 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.