DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and PFS2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_565263.1 Gene:PFS2 / 814678 AraportID:AT2G01500 Length:271 Species:Arabidopsis thaliana


Alignment Length:189 Identity:41/189 - (21%)
Similarity:71/189 - (37%) Gaps:42/189 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 SNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSR 179
            ||::..:|:..      ||...||.:..|..|.:  |....:::|..|..:....:.:......|
plant     5 SNNNLINYLPL------STTQPPLLLTHCDINGN--DHHQLITASSGEHDIDERKNNIPAAATLR 61

  Fly   180 AAFSHAQVFELERRFAQQRYLSGPE----------RSEMAKSLRLTETQVKIWFQNRRYKTKRKQ 234
            ...:..|:..||     :.|.||..          .|::.|..|:....|..||||.:.:.:.|:
plant    62 WNPTPEQITTLE-----ELYRSGTRTPTTEQIQQIASKLRKYGRIEGKNVFYWFQNHKARERLKR 121

  Fly   235 IQQHEAALLGASKRVPVQVLVREDGST------------TYAHMAAPGAGHGLDPALIN 281
            .::...|::...|.|       :|.|:            ::.|...|...|.||||..|
plant   122 RRREGGAIIKPHKDV-------KDSSSGGHRVDQTKLCPSFPHTNRPQPQHELDPASYN 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 15/62 (24%)
PFS2NP_565263.1 Homeobox 61..115 CDD:395001 15/58 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.