DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and HB17

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_178252.2 Gene:HB17 / 814671 AraportID:AT2G01430 Length:275 Species:Arabidopsis thaliana


Alignment Length:279 Identity:61/279 - (21%)
Similarity:96/279 - (34%) Gaps:91/279 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 RQPSNYLQYYAAAMDNNNHHHQAT----GTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSD 149
            :.|:|.|....|.:..|:.:...|    |.|:|..:|.     ...|......|||.|.      
plant    64 KNPNNSLIKIMAILPENSSNLDLTISVPGFSSSPLSDE-----GSGGGRDQLRLDMNRL------ 117

  Fly   150 CDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRL 214
                 |.|....:...|||......:|:.|.....:::  ||..|.|...|:..::..:||.|.|
plant   118 -----PSSEDGDDEEFSHDDGSAPPRKKLRLTREQSRL--LEDSFRQNHTLNPKQKEVLAKHLML 175

  Fly   215 TETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDPAL 279
            ...|:::||||||.::|.||.:            :..:.|.|..||.|..:              
plant   176 RPRQIEVWFQNRRARSKLKQTE------------MECEYLKRWFGSLTEEN-------------- 214

  Fly   280 INIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPI------PPPTQSSSFVT----------A 328
                 |:|                      |:..:.:      |....|:|.:|          |
plant   215 -----HRL----------------------HREVEELRAMKVGPTTVNSASSLTMCPRCERVTPA 252

  Fly   329 SSASSSPVPIPIPGAVRPQ 347
            :|.|.:.||:|......||
plant   253 ASPSRAVVPVPAKKTFPPQ 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 17/52 (33%)
HB17NP_178252.2 HOX 136..192 CDD:197696 18/57 (32%)
HALZ 194..237 CDD:128634 11/95 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.