DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and NANOG

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_079141.2 Gene:NANOG / 79923 HGNCID:20857 Length:305 Species:Homo sapiens


Alignment Length:244 Identity:62/244 - (25%)
Similarity:94/244 - (38%) Gaps:67/244 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PLCCRDLGLYKLTQPKEIQPS---ARQPSNY--LQYYAAAMDNNNHHHQATGTSNSSAADYMQRK 126
            |.|.:.|..::.:..||..|.   .....||  ||..:|.|.     |..|.:...|:.|.:.: 
Human     5 PACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMP-----HTETVSPLPSSMDLLIQ- 63

  Fly   127 LAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLS-------RKKRSRAAFSH 184
                                    |||...:|...:.|.|.:.|...       :|:::|..||.
Human    64 ------------------------DSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSS 104

  Fly   185 AQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRV 249
            .|:..|..||.:|:|||..:..|::..|.|:..|||.||||:|.|:||.|.........|.:::.
Human   105 TQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKA 169

  Fly   250 PVQVLVREDGSTTYAHMAAPGAGHGLDPALINIYRHQ--LQLAYGGLPL 296
                     .:.||             |:|.:.| ||  |....|.||:
Human   170 ---------SAPTY-------------PSLYSSY-HQGCLVNPTGNLPM 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 23/52 (44%)
NANOGNP_079141.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96 23/120 (19%)
COG5576 74..191 CDD:227863 39/139 (28%)
HOX 95..151 CDD:197696 24/55 (44%)
Required for DNA-binding. /evidence=ECO:0000269|PubMed:25825768 122..151 12/28 (43%)
8 X repeats starting with a Trp in each unit 196..240 62/244 (25%)
Sufficient for transactivation activity. /evidence=ECO:0000250 196..240 62/244 (25%)
Sufficient for strong transactivation activity. /evidence=ECO:0000250 241..305
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.