DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and hmx1

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001106998.1 Gene:hmx1 / 797503 ZFINID:ZDB-GENE-080204-54 Length:282 Species:Danio rerio


Alignment Length:148 Identity:55/148 - (37%)
Similarity:72/148 - (48%) Gaps:29/148 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 TLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGL------------------------- 172
            |..:|.:..|.:|..|..|...||:|.|.:..:....||.                         
Zfish    83 TSRSPREESRNSSEYSRSDRDTPLASEPLDGVVDRKMSGCAVDEGDDARQLFDERSGPDTSEPGS 147

  Fly   173 SRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQ 237
            :|||::|..||.:|||:||..|..:||||..||:.:|.||.||||||||||||||.|.||:....
Zfish   148 ARKKKTRTVFSRSQVFQLESTFDMKRYLSSSERAGLAASLHLTETQVKIWFQNRRNKWKRQLAAD 212

  Fly   238 HEAALLGASK----RVPV 251
            .||.....:.    |||:
Zfish   213 LEAVNFNHNSQRIVRVPI 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 33/52 (63%)
hmx1NP_001106998.1 Homeobox 153..206 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.