DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Hoxa5

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_077365.1 Gene:Hoxa5 / 79241 RGDID:620609 Length:381 Species:Rattus norvegicus


Alignment Length:223 Identity:65/223 - (29%)
Similarity:91/223 - (40%) Gaps:58/223 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 EPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQAT 112
            ||...:|::.     :.|||             |..:..||..||         ..:::||....
  Rat   194 EPRYSQPATS-----THSPP-------------PDPLPCSAVAPS---------PGSDSHHGGKN 231

  Fly   113 GTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLS-------SSPSESP------ 164
            ...|||.|.      |..|||   .:..|......|..:...|.|       |.||.:|      
  Rat   232 SLGNSSGAS------ANAGST---HISSREGVGTASAAEEDAPASSEQAGAQSEPSPAPPAQPQI 287

  Fly   165 --------LSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKI 221
                    :|||..|....||:|.|::..|..|||:.|...|||:...|.|:|.:|.|:|.|:||
  Rat   288 YPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKI 352

  Fly   222 WFQNRRYKTKR-KQIQQHEAALLGASKR 248
            ||||||.|.|: .:::....|..|.:.|
  Rat   353 WFQNRRMKWKKDNKLKSMSMAAAGGAFR 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 26/52 (50%)
Hoxa5NP_077365.1 Homeobox 310..363 CDD:365835 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.