DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and lbx1

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001072559.1 Gene:lbx1 / 780014 XenbaseID:XB-GENE-6455157 Length:265 Species:Xenopus tropicalis


Alignment Length:281 Identity:71/281 - (25%)
Similarity:107/281 - (38%) Gaps:98/281 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AGLSKSLTTPFSINDILTRSNPETRRMSSV--------DSEPEPEKLKPSSDRERSISKSPPLCC 70
            |..:|.| |||||.|||.:  |..||..::        .:|..|....|.|.| ..:|::.||| 
 Frog    27 ANSNKPL-TPFSIEDILNK--PSVRRSYTICGTAHLLSTAEKPPAAGLPLSSR-ALLSQTSPLC- 86

  Fly    71 RDLGLYKLTQP--KEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGST 133
               .|.:|...  |.::.|..|                   .|.|...          :..||. 
 Frog    87 ---ALEELASKTFKGLEVSVLQ-------------------AAEGRDG----------MTIFGQ- 118

  Fly   134 LAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQR 198
                                       .::|        .::::||.||::.|::|||:||..|:
 Frog   119 ---------------------------RQTP--------KKRRKSRTAFTNHQIYELEKRFLYQK 148

  Fly   199 YLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQV---------- 253
            |||..:|.::|:.|.||..||..||||||.|.|| .:::.:|.:....|..|..|          
 Frog   149 YLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKR-DLEEMKADVESVKKMSPSTVEAVLTISELE 212

  Fly   254 ----LVREDGSTTYAHMAAPG 270
                .||:|..:....:...|
 Frog   213 EETNSVRDDSRSRSPQLGLSG 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 28/52 (54%)
lbx1NP_001072559.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33 2/5 (40%)
Homeobox 128..182 CDD:365835 28/53 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..265 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.