DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Nanog

DIOPT Version :10

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_082292.1 Gene:Nanog / 71950 MGIID:1919200 Length:305 Species:Mus musculus


Alignment Length:107 Identity:21/107 - (19%)
Similarity:34/107 - (31%) Gaps:41/107 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 YDYHFYSPDVPQTGLNAPLYRRANEQSLLGTLNINTSVHY---WLSAGLDKSKLILGLPTYGHSF 417
            |:||:    ...|.:..|:...|.:           .:.|   |:...||...|           
Mouse    93 YEYHW----ADGTNIKKPIKCSAPK-----------FIDYLMTWVQDQLDDETL----------- 131

  Fly   418 TLVNPFNTRIGAPASSYGRVGTFGFASYSETCWFRRYNIYVH 459
                 |.::||.|...       .|.|.::|...|.:.:|.|
Mouse   132 -----FPSKIGVPFPK-------NFMSVAKTILKRLFRVYAH 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeodomain 176..232 CDD:459649
NanogNP_082292.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..95 1/1 (100%)
Sufficient for interaction with SALL4. /evidence=ECO:0000269|PubMed:16840789 96..155 16/96 (17%)
Homeodomain 98..153 CDD:459649 15/88 (17%)
Required for DNA-binding. /evidence=ECO:0000250|UniProtKB:Q9H9S0 123..152 10/51 (20%)
PTZ00395 <190..>250 CDD:185594
10 X repeats starting with a Trp in each unit 198..247
Sufficient for transactivation activity 198..247
Sufficient for strong transactivation activity 248..305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.