DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and NKX2-1

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001073136.1 Gene:NKX2-1 / 7080 HGNCID:11825 Length:401 Species:Homo sapiens


Alignment Length:434 Identity:113/434 - (26%)
Similarity:151/434 - (34%) Gaps:161/434 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ESAGVSAAMAG--------------LSKSLTTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPS 55
            ::.|..||..|              :|...|||||::|||:                      |.
Human     8 KARGWEAAAGGRSSPGRLSRRRIMSMSPKHTTPFSVSDILS----------------------PL 50

  Fly    56 SDRERSISKSPPLCCRDLGLYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAA 120
            .:..:.:..........|..|:       |..|..|:..:|.:|.     .||...|...:.:||
Human    51 EESYKKVGMEGGGLGAPLAAYR-------QGQAAPPTAAMQQHAV-----GHHGAVTAAYHMTAA 103

  Fly   121 DYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSS-------------------PSESPLS 166
            ...|...:..|.         .|..|..:....||...:                   |:.|...
Human   104 GVPQLSHSAVGG---------YCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFM 159

  Fly   167 HDGSGLS------------------------RKKRSRAAFSHAQVFELERRFAQQRYLSGPERSE 207
            ...||::                        |:|| |..||.|||:||||||.||:|||.|||..
Human   160 GPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKR-RVLFSQAQVYELERRFKQQKYLSAPEREH 223

  Fly   208 MAKSLRLTETQVKIWFQNRRYKTKR--------KQIQ---------------QHEAALLGASKRV 249
            :|..:.||.|||||||||.|||.||        :|:|               |.:.|...:.:||
Human   224 LASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRV 288

  Fly   250 PVQVLVREDGSTTYAHMAAPGA----GHGLDPALINIYRHQLQLAY----------GGLPLPQMQ 300
            .|.|||: ||....|...||||    ||....|     :||.|.|.          ||..|..  
Human   289 AVPVLVK-DGKPCQAGAPAPGAASLQGHAQQQA-----QHQAQAAQAAAAAISVGSGGAGLGA-- 345

  Fly   301 MPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPVPIPIPGAV 344
                  :|.|:      |.:...|...|..|:|   |..:.|.|
Human   346 ------HPGHQ------PGSAGQSPDLAHHAAS---PAALQGQV 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 35/52 (67%)
NKX2-1NP_001073136.1 Homeobox 194..247 CDD:278475 36/53 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.