DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Nkx6-3

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001102925.1 Gene:Nkx6-3 / 685102 RGDID:1597780 Length:262 Species:Rattus norvegicus


Alignment Length:230 Identity:72/230 - (31%)
Similarity:101/230 - (43%) Gaps:60/230 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PLCCRDL--GLYKLTQP--------------KEI--QPSARQPSNYLQYYAAAMDNNNHHHQATG 113
            |:|...:  ..|||:.|              .:|  :|.|...|:.|..|.         |.|..
  Rat    25 PMCQYSVQNSFYKLSPPGLGPQLAAGTPHGITDILSRPVATPNSSLLSGYP---------HVAGF 80

  Fly   114 TSNSSAADYMQRKLAYFGST-LAAPLDMRRCTSNDSDCD---SPPPLSSSPSESPLSHDGSGLSR 174
            ...||...|...::..|..| ...|...|.|.: |:..|   |..|.|::|  .|||   ..:.:
  Rat    81 GGLSSQGVYYGPQVGSFSKTGNEYPTRTRNCWA-DTGQDWRGSTRPCSNTP--DPLS---DTIHK 139

  Fly   175 KKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHE 239
            ||.:|..|:..|:|.||:.|.|.:||:||||:.:|.||.:||:|||:||||||.|.::|      
  Rat   140 KKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKK------ 198

  Fly   240 AALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHG 274
            :||              |..|:|   ..|||...|
  Rat   199 SAL--------------EPSSST---PRAPGGASG 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 29/52 (56%)
Nkx6-3NP_001102925.1 Homeobox 143..197 CDD:395001 29/53 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.