DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Mnx1

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001258203.1 Gene:Mnx1 / 682076 RGDID:1588091 Length:403 Species:Rattus norvegicus


Alignment Length:206 Identity:63/206 - (30%)
Similarity:89/206 - (43%) Gaps:38/206 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 IQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAY---FGSTLAAPLDMRRCTS 145
            :.|...|....|...||...:..:.:.|...:.:.|..:.....:|   .|:..|.|.|..:..:
  Rat   141 LHPGGAQGGAGLPAQAALYGHPVYSYSAAAAAAALAGQHPALSYSYPQVQGAHPAHPADPIKLGA 205

  Fly   146 NDSDCDS------------PPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQR 198
            .....|.            ..|..||.::|.|      |.:.:|.|.||:..|:.|||.:|...:
  Rat   206 GTFQLDQWLRASTAGMILPKMPDFSSQAQSNL------LGKCRRPRTAFTSQQLLELEHQFKLNK 264

  Fly   199 YLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTY 263
            |||.|:|.|:|.||.||||||||||||||.|.||.:..:.:||          |...::.||   
  Rat   265 YLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAKEQAA----------QEAEKQKGS--- 316

  Fly   264 AHMAAPGAGHG 274
                ..|||.|
  Rat   317 ----GGGAGKG 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 32/52 (62%)
Mnx1NP_001258203.1 Homeobox 244..297 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.