DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Cdx2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_076453.1 Gene:Cdx2 / 66019 RGDID:621234 Length:310 Species:Rattus norvegicus


Alignment Length:282 Identity:66/282 - (23%)
Similarity:102/282 - (36%) Gaps:116/282 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 SNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPL 156
            |:..:|:|....:::.||.|  .:.|.|:..:|                   |.|    ..||..
  Rat   107 SSPAEYHAHHHPHHHPHHPA--AAPSCASGLLQ-------------------TLN----PGPPGP 146

  Fly   157 SSSPSESPLSHDGS----------------GLSRKKRS----RAAFSHAQVFELERRFAQQRYLS 201
            :::.:...||..|.                |...|.|:    |..::..|..|||:.|...||::
  Rat   147 AATAAAEQLSPSGQRRNLCEWMRKPAQPSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYIT 211

  Fly   202 GPERSEMAKSLRLTETQVKIWFQNRRYKTK---RKQIQQHEAALLGASKRVPVQVLVREDGSTTY 263
            ...::|:|.:|.|:|.||||||||||.|.:   :|::||.:      .::.|             
  Rat   212 IRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQ------QQQPP------------- 257

  Fly   264 AHMAAPGAGHGLDPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQ----HKVPQPIPPPTQSSS 324
                ||                         |.||...      ||    ..||:|:.|      
  Rat   258 ----AP-------------------------PPPQPSQ------PQSGALRSVPEPLSP------ 281

  Fly   325 FVTASSASSSPVPIPIPGAVRP 346
             ||:...|   ||..:||.:.|
  Rat   282 -VTSLQGS---VPGSVPGVLGP 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 24/56 (43%)
Cdx2NP_076453.1 Caudal_act 13..170 CDD:282574 16/87 (18%)
Homeobox 189..241 CDD:278475 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.