DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Vax2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_072159.1 Gene:Vax2 / 64572 RGDID:621133 Length:292 Species:Rattus norvegicus


Alignment Length:249 Identity:68/249 - (27%)
Similarity:107/249 - (42%) Gaps:46/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 HQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSP-SESPLSHDGSG- 171
            |:......:.......|::|  |::.::|...|   .:..|.|....|..:. ....|..|..| 
  Rat    28 HRGAEDLRADTGSTSPREIA--GTSASSPAGSR---ESGGDSDGQQALGETDHCRRILVRDAKGT 87

  Fly   172 -----------LSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQN 225
                       |.|.||:|.:|:..|::.||..|.:.:|:.|.||:|:|:.|.|:|||||:||||
  Rat    88 IREIVLPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQN 152

  Fly   226 RRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDPA-LINIYRHQLQL 289
            ||.|.|:.|.:..|       ||.         .|:.:...|.......|:.. |:::.|....|
  Rat   153 RRTKQKKDQSRDLE-------KRA---------SSSAFEAFATSNVLRLLEQGRLLSVPRAPSLL 201

  Fly   290 AYG-GLP-LPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPVPIPIP 341
            |.. ||| |...........|::...:..|.|         |:::|||:|.|:|
  Rat   202 ALSPGLPGLTAGHRGTSLGDPRNSSQRLNPMP---------SASASSPLPPPLP 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 26/52 (50%)
Vax2NP_072159.1 vax upstream domain 74..101 4/26 (15%)
homeobox 102..161 29/58 (50%)
Homeobox 105..158 CDD:278475 26/52 (50%)
vax downstream domain 182..193 2/10 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..241 6/37 (16%)
vax terminal domain 266..274
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.