DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and nkx2.4b

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_571664.1 Gene:nkx2.4b / 58112 ZFINID:ZDB-GENE-000830-1 Length:307 Species:Danio rerio


Alignment Length:280 Identity:88/280 - (31%)
Similarity:126/280 - (45%) Gaps:69/280 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LSKSLTTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQ 80
            ||...:||||::|||:               |..|..|..:..|.|.|.:.|       ||:.:|
Zfish     3 LSPKHSTPFSVSDILS---------------PIEETFKKFAAMESSASLASP-------LYRQSQ 45

  Fly    81 PKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRR-CT 144
            ..:        :|..|:   :|.:|.:|...:..|:|:...|....:...|...:....||. .|
Zfish    46 VSQ--------ANLQQH---SMSHNAYHMPHSQFSHSTMGGYCNGTIGAMGDLPSYQESMRNGAT 99

  Fly   145 SNDSDCDSPPPLSSSPSESPLSHDGSGLS--------------------RKKRSRAAFSHAQVFE 189
            :......:|.|  ..|:.|......:|::                    |:|| |..||.|||:|
Zfish   100 ATAWYGSNPEP--RYPTISRFMGPSAGMNMGTLPGMDASKSMVTLHAAPRRKR-RVLFSQAQVYE 161

  Fly   190 LERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKR----KQIQQHEAALLGAS---K 247
            |||||.||:|||.|||..:|..:.||.|||||||||.|||.||    |..||.::..:.|.   :
Zfish   162 LERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKASQQQDSGNMCAQQSPR 226

  Fly   248 RVPVQVLVR-----EDGSTT 262
            ||.:.|||:     ::||.|
Zfish   227 RVALPVLVKDGKPCQNGSGT 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 35/52 (67%)
nkx2.4bNP_571664.1 Homeobox 150..203 CDD:278475 36/53 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.